KEGG   Ralstonia solanacearum PSI07: RPSI07_2095Help
Entry
RPSI07_2095       CDS       T01273                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_2095 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPSI07_2095 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RPSI07_2095 (sucB)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPSI07_2095 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2189654..2190916)
Genome map
AA seq 420 aa AA seqDB search
MAIVDVKVPQFSESVEEGTLISWKKKPGEAVAVDEVLVEIETDKVVLEVPAPSAGVLAEV
LVADGATVASEQLLAKIDTEGKAGAAATAAVASAPAAAAPAPVAAAPASAAAAATGGVAM
PSAAKLMAEANLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAPAAAPQAARPALQQVAAP
VDFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFE
KTHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSLADIEKKIAEFGVKARDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgatgtcaaggtcccgcagttttccgaatccgtcgaagaaggcacgctg
atctcctggaagaagaagccgggtgaagccgtggccgtggacgaagtcctggtcgaaatc
gagaccgacaaggtcgtgctggaagtgccggccccgtcggctggcgtgctggctgaagtg
ctggtggccgacggcgccaccgtggcgtcggaacagttgctggccaagatcgacaccgaa
ggcaaggcgggcgctgctgccacggctgccgttgcatcggctccggccgctgccgcgccc
gcaccggtcgctgctgcgccggcctcggctgccgctgccgccaccggtggcgtggccatg
ccgtcggctgccaagctgatggccgaagccaacctgtcggctggccaagtggccggcacg
ggccgcgatggccgcatcaccaagggcgacgtgctgggtgccgtggccggcggtgccaag
ccggctccggccgccgcaccgcaggccgcgcgtccggccctgcagcaagtggctgcgccg
gtggacttcgccgccctgggcgaccgtccggaagagcgcgtgccgatgagccgcctgcgc
gcccgcatcgccgagcgcctggtgcagtcgcagtcgaccaacgccatcctcaccaccttc
aatgaagtcaacatgaagccggtgatggacttgcgcgccaagttcaaggaccagttcgag
aagacccacggcgtgaagctgggcttcatgtcgttcttcgtgaaggccgccgtccacgcg
ctgaagaagtacccggtcatcaacgcctcggtggatggcaacgacatcgtctaccacggc
tacttcgacatcggtatcgccgtcggctcgccgcgcggcctggtggtgcccatcctgcgc
aatgccgaccagatgagcctggccgacatcgagaagaagatcgctgaattcggcgtcaag
gcccgcgacggcaagctgacgctggacgacctgaccggcggcacgttctcgatctccaac
ggcggtaccttcggttcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatc
ctgggcgtgcacgcgaccaaggaccgcgccgtggtggagaacggccaagtcgtggtccgc
ccgatgaactacctggccatgtcctacgaccaccgcatcatcgacggccgcgaagccgtg
ctgggcctggtggcgatgaaggaagcgctggaagacccggcccgcctgctgctggacctg
taa

DBGET integrated database retrieval system