KEGG   Ralstonia solanacearum PSI07: RPSI07_2172Help
Entry
RPSI07_2172       CDS       T01273                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
Enzymes [BR:rsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RPSI07_2172 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2277305..2278270)
Genome map
AA seq 321 aa AA seqDB search
MSERARGRRFPLTLDAVVERKPAERQRETRISSGVNAVSRQTPARTASAERVNAVPAPGP
VPQRVAGVDAAVGAVAASAVQARTQAAHAAAGGMASDRARQALVARVQAAGVTDARVLAA
IGRVPRHLFVDAGLASQAYEDAALPIGHQQTISKPSVVGRMIELLLRGRLDPSARAAQAL
AQPLSRVLEIGTGCGYQAAVLSQVAGEVYSIERIRPLHEKAKANLRPLRVPNIRLHYGDG
MLGLPKAAPFDAIIVAAAGLEVPQALLDQLAIGGRLIAPVATDRAGGPSQQLVLIERRGR
FQFHSTALEGVFFVPLKSGTV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgtgcacgcggtcggcgctttccgttgacgctcgacgcggtggtcgagcgc
aagccggccgagcgtcagcgcgagacgcggatttcgtccggcgtgaacgccgtgtcgcgg
cagacgcccgcgcgtacggcttccgccgagcgcgtgaatgccgtgccagcgccgggcccg
gtgccgcagcgcgtggcgggcgtcgatgctgccgtcggcgccgtggcggccagcgcggtg
caggcacgcacccaggctgcgcacgcagccgccggcggcatggcctcggatcgcgcgcgc
caggcgctggttgcccgcgtgcaggccgcaggcgtgaccgatgcgcgcgtgctggccgcg
atcggcagggtgccgcgccacctgttcgtcgatgccgggctcgcctcgcaggcatacgaa
gatgccgcgctgccgatcggccaccagcagaccatttccaagccctcggtcgtcggccgc
atgatcgagctgctgttgcggggacgtctcgatccgtccgcgcgggctgcgcaggcgctc
gcgcaaccgttgtcgcgcgttctcgagatcggcaccggctgcggctatcaggccgcggtg
ctgtcgcaggtggccggcgaagtgtattcgatcgaacgcatccgtccgctgcacgagaaa
gccaaagcgaacttgcggccacttcgcgtgccaaacatccgcctgcattacggcgacggc
atgctggggctgcccaaggccgcgccgttcgatgccatcatcgtggccgccgcggggctg
gaggtgccgcaggcactgctcgaccagcttgccatcggcggccggctgatcgcaccggtg
gcgacggaccgcgccggcggaccgtcgcagcaactcgtgctgatcgagcgtcgcggccgc
ttccagtttcacagtaccgcgcttgaaggcgttttctttgtcccgttaaaatcaggaact
gtttag

DBGET integrated database retrieval system