KEGG   Ralstonia solanacearum PSI07: RPSI07_2183Help
Entry
RPSI07_2183       CDS       T01273                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RPSI07_2183 (recR)
DNA repair and recombination proteins [BR:rsl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RPSI07_2183 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2287754..2288374)
Genome map
AA seq 206 aa AA seqDB search
MRGGPGTPSALQMLIEALRVLPGVGPKSAQRMAYHLLQHDREGASRLAEALAEAAESIRH
CSRCNTFTEQDVCETCLDPRRDASVLCVVETPADQMMIEQTLTYRGQYFVLMGRLSPLDN
IGPKEIHLERLLARATDPALGGPCAEVILATNFTSEGEATAHYIGEMLKARGIKASRLAR
GVPVGGELEYVDAGTIARAVLDRRQL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcggtccgggcacgccatcggcgctgcagatgctgatcgaggccttgcgcgtg
ctgccgggcgtggggccgaagtctgcgcagcgcatggcctatcacctgctgcagcacgac
cgcgaaggcgcgtcgcggctggccgaagcgctggccgaggcggccgagtcgatccgccat
tgcagccgctgcaacactttcaccgagcaggacgtctgcgagacctgcctggatccgcgc
cgcgacgcctcggtgctgtgcgtggtggaaacgcctgccgaccagatgatgatcgagcag
acgctcacctaccgcggccagtatttcgtgctgatggggcggctctcgccgctggacaac
atcggccccaaggaaatccaccttgagcgcctgctggcccgggcgaccgacccggcgctg
ggcgggccgtgcgccgaagtcattctcgccaccaacttcaccagtgaaggcgaggccacc
gcacactacatcggcgagatgctgaaggcgcgcggtatcaaggcgtcgcggctggcgcgc
ggggtgccggtgggcggcgagctggaatacgtggatgcgggcaccatcgcccgcgcggtg
ctggaccggcgccagctctga

DBGET integrated database retrieval system