KEGG   Ralstonia solanacearum PSI07: RPSI07_2324Help
Entry
RPSI07_2324       CDS       T01273                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rsl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:rsl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2444047..2445099)
Genome map
AA seq 350 aa AA seqDB search
MNSITNKQKRPGPIVLDVAGLALGPDDVRRIVHPLTGGVILFARNFESRAQLMALTAAIR
AVRDDVLICIDHEGGRVQRAKQDGFTHLPAMAALGQLWDRDVLAATRVATACGYVLAAEL
RACDIDLSFTPVLDLDYGASSVIGDRAFHRDPRVVTMLANHLTLGLRLAGMANCGKHFPG
HGWVQADSHVAVPVDDRPLQAILDEDAQPYGWMGIGLQSVMPAHVIYSAVDPNPAGFSRF
WLQDILRTHYNFDGVIFSDDLSMEGASVAGSVVDGARAALAAGCDMVLICNAPDKADRLL
NELDVKIGKASQRRIRRLFGGKAAKDWSKLAQQSAYQQALRTLREARLIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatcaccaacaagcagaagcgccctggcccgatcgtcctcgacgtggccggg
ctcgcactcggccctgacgatgtccgccgcatcgtgcatccactgaccggcggcgtgatc
ctgtttgcgcgcaacttcgagtcgcgcgcgcaattgatggcgctgaccgctgcgatccgg
gctgtgcgcgatgacgtgctgatctgcatcgatcacgagggtggtcgcgtgcagcgtgcc
aagcaagatggcttcacgcatctgccggcgatggccgcgctgggccagctgtgggaccgc
gacgtcctggccgccacgcgcgtggccaccgcgtgcgggtatgtgctggcggcagaactg
cgcgcctgcgacatcgacctgagcttcacgccggtgctggatctcgactatggcgccagc
agcgtgatcggtgaccgtgccttccaccgcgatccgcgcgtggtgacgatgcttgccaac
cacctgacgctgggcctgcgcctggccggcatggccaactgcggcaagcatttccccggc
cacggctgggtccaggccgattcgcacgtcgccgtgccggtcgacgatcggccgctgcag
gcgatcctcgacgaagatgcccagccctacgggtggatggggatcggcctgcagtcggtg
atgccggcgcatgtcatctactcggcggtcgatccgaacccggcgggtttctctcgcttc
tggctgcaggacatcctgcgcacgcactacaacttcgacggcgtgatcttcagcgacgac
ctgagcatggaaggcgccagcgttgcgggctcggtggtcgacggcgcacgcgcggcactg
gcggccggttgcgacatggtgctgatctgcaatgcgccggacaaggccgaccggctgctg
aacgaactggacgtgaagatcggcaaggcgtcgcagcgacgcatccgccggctgttcggc
ggcaaggcggccaaggactggtcgaagctggcgcagcagtcggcgtaccagcaggcgctg
cggacgctgcgcgaggcgcggctgatcgcctag

DBGET integrated database retrieval system