KEGG   Ralstonia solanacearum PSI07: RPSI07_2382Help
Entry
RPSI07_2382       CDS       T01273                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RPSI07_2382 (rbsK)
Enzymes [BR:rsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RPSI07_2382 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2498057..2499004
Genome map
AA seq 315 aa AA seqDB search
MVAKRSVLSSTAADVLVVGSLNMDLVIRTPRLPYPGQTVAAPALETIPGGKGANQAVAAA
RLGGRVAMLGCVGDDPHGTALREGLRREGVDTAMVTAHAGAPTGIACVTVADSGQNTIVI
VAGANRQLTPAMIDAQQAAFERAKVIVCQLESPLDAVERALLLGQRLGKTVILNPAPAAG
PLPTPWLAACDYLIPNETEAALLTARPVDSPEAALAAADDLHAQGARHVIITLGARGIAY
VDATTRLLMPAHPAQAIDTTAAGDTFVGALATALAEGAAPAEAIQFGQAAAAVSVTRLGA
QPSIPFRSELASPVQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaagcgttcggttctctcctcaaccgctgccgacgtgctggtcgtcggcagc
ctcaacatggatctcgtgatccgcacccctcgtttgccctatcccgggcaaacggttgcg
gcgccggcgctggagaccatccccggcggcaagggcgccaaccaggccgtggccgcggca
cgcctgggcggccgcgttgccatgctcggctgcgtgggcgacgacccccatggcacggcc
ttgcgggaaggcctgcggcgggaaggcgtcgataccgcgatggtgaccgcgcatgcgggc
gcgcccacgggcatcgcctgcgtgacggtggccgacagcgggcagaacaccatcgtgatc
gtggccggcgccaaccggcagctgaccccggcgatgatcgacgcgcagcaggccgccttc
gagcgggccaaggtcattgtctgccagctggagtcccccctggatgcggttgagcgcgcg
ctgctgctcgggcagcggctgggcaagactgtcatcctgaacccggcgcccgccgccggt
ccgctgccgacgccatggcttgctgcctgcgactacctgatccccaacgagaccgaagcc
gcgctgctgacggcgcggccggtggattcgcccgaggcggcgctggccgccgccgacgac
ctgcatgcgcaaggcgcgcgccacgtcatcatcacgctgggcgcgcgcggcatcgcctac
gtggatgcgaccacccgcctgctgatgccggcccaccccgcgcaggccatcgacaccacc
gcggccggcgataccttcgtcggcgcactggccacggcgctggcggagggcgcggcaccg
gccgaggcgatccagttcggccaggccgccgccgcggtgtcggtcacgcgcctgggcgcg
cagccctcgattccgttccgcagcgaactggcatcgccggtgcaatag

DBGET integrated database retrieval system