KEGG   Ralstonia solanacearum PSI07: RPSI07_2572Help
Entry
RPSI07_2572       CDS       T01273                                 

Definition
(RefSeq) putative Beta-hexosaminidase A precursor (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Chitobiase) (EC:3.2.1.52)
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RPSI07_2572
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    RPSI07_2572
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RPSI07_2572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2704747..2706951)
Genome map
AA seq 734 aa AA seqDB search
MQIDELKLAKMPGHPPDVRGDRADGSPIRSGRRPGWLARRSIRPKPAMKVLRVLRQCVLG
LAVLSLAACSSDDETATDAQLKEQALQIVGQMSTRDKIGQKIMMAFRYWCEPPADSNCTD
RMTVLPDAAASALRDHRIGGVVLFANNLVSVDQISRLTAQIAAAAPVGMLIGVDEEGGNV
FRLPRGIATSFPGNMALGAAYLGAADAALAHDEGRVLASELAAVGMNVNFAPVVDVNSNP
LNPVINVRAYGDDPAMVGLLGRHMARGMAHAGVISAFKHFPGHGDAATDSHYGLPRVDKS
RADAYATDLAPYRASIDLGEAPEMIMTAHIQYPSLDETRIATRTGESILVPATMSRKIQH
DLLRGEFGYRGVTVSDALDMDAIANHFDPDQAVINLFRADVDIALMPVEFRTAGQADRLR
AVIDRVVAALDAGTLSRAELDASVERITLMKLRHGIAPNASRPQTSAATVIGSPSHRAVE
QRIAQASITLLRNRSATLPLNAPQRPIFIMTPWGEQAQGMRQRFAELGYASVTGAKLAET
PWAEQQRLIDAADIVILGTLSSAPSPVERNGDPRAADTRTNTASVQESAAPLVGDKRPEA
VVHGQRSLVFDVEEDAPTVPGVLRAQQVSAPSEAQRVRYAMEYAKAKGKTVIHVSLRAPY
DVPSFDDVADATVATYSYYGYDNSAWRGPSMPALVDALAGVRSPLGRLPVSVYEVNTDGK
LGSLRYARGFGMRY
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgacgaactcaaacttgccaagatgccggggcatcccccggatgtgcgcggc
gatcgggctgacggcagtccaatccgttctggtcgccgccccggatggctggcccggcgc
tccatccggccgaaaccggcgatgaaggtgttgcgcgttcttcgccagtgcgtgctgggt
cttgcggtgctctcgttggccgcgtgctcgtctgatgatgaaaccgcaactgacgcgcag
ttgaaggagcaggcactgcagatcgtcgggcagatgtcgacgcgcgacaagatcgggcaa
aagatcatgatggcgttccgctactggtgcgagccgcctgccgattccaactgcacggat
cgcatgacggtactgcccgacgctgccgccagcgcgttgcgcgatcaccgcatcggcggc
gtggtcctgttcgcgaacaacctcgtatcggtcgatcagatcagccgcctgacggcgcag
atcgctgcggcggcgccggtcggcatgctgatcggcgtcgacgaggaaggcggcaacgtg
ttccggttgccgcgtggcatcgcgacgtcgtttcccgggaacatggcgctcggagcggca
tacctgggtgccgccgatgcggcactcgcccacgatgagggacgcgtgctcgcatccgaa
ctggcggcggtcggcatgaatgtcaactttgcgccggtggtcgacgtcaacagcaatccg
ctgaatcccgtcatcaatgtgcgcgcctacggcgatgatccggccatggtcggcctgctc
ggccgccacatggcgcgcggcatggcccacgcgggcgtcatcagcgcattcaagcacttc
ccgggccacggggatgcggcaaccgattcgcactatgggctgccgcgcgtggacaagtcg
cgtgccgacgcatacgcgaccgacctcgcgccgtatcgcgcatcgattgacctgggcgaa
gcgccggagatgatcatgaccgcgcatatccagtatccgtcgcttgacgaaacccggatc
gcgacgcgcaccggcgagagcatcctggtgccggccaccatgtcgcgcaagatccagcac
gacctgctgcgcggcgagttcggctaccgcggcgtgacggtctccgatgcgctcgacatg
gacgcgatcgcgaaccacttcgatcccgatcaggcggtgatcaacctgttccgcgccgac
gtcgacatcgcgctgatgcccgtcgagttccgcacggccggccaggccgatcggctccgt
gcggtgatcgaccgcgtcgtggccgcgctggatgccggcacgctgagtcgcgccgagctg
gatgcatcggtcgagcgcatcacactgatgaagctgcgccacgggatcgcaccgaacgca
tcgcgcccgcagacatctgcggcaacggtgatcggcagccccagccatcgggcagtcgag
cagcgcattgcgcaggcatcgatcacgctcttgcgcaatcgcagcgcgacgctgccgctg
aacgcgccgcaacggccgatcttcatcatgacgccctggggcgagcaggcccaggggatg
cgccagcgcttcgccgaactcggctacgcttcggtgaccggcgcgaagctggcggagacg
ccctgggccgagcagcaacggttgatcgatgccgccgacatcgtgattctcgggaccctg
tcgagcgccccctcgccggtcgagcgcaacggcgatccgcgcgccgccgacacgcggacg
aataccgcctcggtgcaggagagcgccgcgccgctcgtcggcgacaagcgccccgaggcc
gttgtgcacgggcaacgctccctggtcttcgatgtcgaggaggacgcgccgaccgtgccc
ggggtgctgcgcgcgcaacaggtctccgcgccaagcgaagcgcagcgggtccgctatgcg
atggagtacgccaaggcgaagggcaagaccgtcatccacgtatcactgcgcgcgccgtac
gacgtgccttcgttcgacgatgtcgccgacgcgacggttgccacctattcgtactacggc
tacgacaacagcgcctggcgcggtccgtcgatgccggcactggtcgatgcgctggccggt
gtgcgctcgccgcttggccgcctgccggtgtcggtgtacgaggtgaacacggacggcaag
ctgggttcactgcgttacgcgcgcggcttcgggatgcgctactga

DBGET integrated database retrieval system