KEGG   Ralstonia solanacearum PSI07: RPSI07_2659Help
Entry
RPSI07_2659       CDS       T01273                                 

Gene name
cpsG
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_2659 (cpsG)
   00030 Pentose phosphate pathway
    RPSI07_2659 (cpsG)
   00051 Fructose and mannose metabolism
    RPSI07_2659 (cpsG)
   00052 Galactose metabolism
    RPSI07_2659 (cpsG)
   00500 Starch and sucrose metabolism
    RPSI07_2659 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    RPSI07_2659 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    RPSI07_2659 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPSI07_2659 (cpsG)
Enzymes [BR:rsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RPSI07_2659 (cpsG)
    5.4.2.8  phosphomannomutase
     RPSI07_2659 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2786976..2788361)
Genome map
AA seq 461 aa AA seqDB search
MQIDPSIFKAYDIRGIVGKNVDRETARLIGRAFGSAARANGEAAVVIGRDGRLSGPDLVA
GLAEGLRQSGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVLS
GQAIYGEQIQALRQRIEQGAFTEGAGTYVQVDVRQQYIDRIVSDVKVARPMKIAVDCGNG
VAGAFAPALFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRHPGGEIIFDVKCTGKLAPFIREHGGKAT
MWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEILSRHADPSAV
LNALPNSHCTPELQLKCAEGEPFALLDKIKANATFDGAKEVLRIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDVAMARIQGEFRRVILAEKPDAKLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgacccctccatcttcaaggcctatgacattcgcggcatcgtcggcaagaac
gtcgaccgtgaaaccgcgcggctgatcggccgggccttcggttcggcggcccgcgccaac
ggcgaggccgccgtggtgatcggccgcgatggccgcctgtccggtccggatctcgtggcc
ggcctggccgaaggcttgcgccagagcggtgtggacgtgatcgaccttgggctggtggcc
acgccgatggtctacttcggcaccaacatcgaactcgcaggccgccgcgccacgtccggc
gtgatggtcaccggcagccacaacccgcccgactacaacggcttcaagatggtgctgtcc
ggccaggctatctacggcgagcagatccaggcgctgcgccagcgcatcgagcagggtgcg
ttcaccgagggcgccggcacgtatgtccaggtggacgtgcgccagcagtacatcgaccgc
atcgtctccgacgtcaaggtggcgcggccgatgaagatcgcggtggactgcggcaatggc
gtggcgggcgcgttcgcgccggcgctgttccgcgccatgggctgcgaggtgacggagctg
ttctgcgaggtggatggccatttcccgaaccaccatccggatccggcccatgtcgagaac
ctgcaggatctcgtgcgcacgctgcagacgaccgactgcgagctcggcctggccttcgat
ggcgacggcgaccgtctgggcgtggtcaccaaggatggccaggtgatcttcccggaccgc
cagctgatgctgttcgcccaggaggtgctgtcgcgccacccgggcggcgagatcatcttc
gacgtgaagtgcaccggcaagctggcgccgttcatccgcgaacatggcggcaaggccacg
atgtggaagacgggacactcgctggtcaaggccaagctgaaggaaaccggtgcgccgctg
gccggcgagatgagcggccatatcttcttcaaggaccgctggtacggcttcgacgatggc
ctgtacaccggggcgcgcctgctggaaatcctgtcgcgccacgccgatccgagcgccgtg
ctgaacgcgctgccgaattcgcattgcacgccggagctacagctcaagtgcgccgagggc
gagccgttcgcgctgctcgacaagatcaaggccaatgcgacgttcgacggtgcgaaagaa
gtgctccgcatcgacggcgtgcgcgtggagtatgccgatggcttcggcctggcgcgcccg
tccaacaccaccccggtggtggtgatgcgcttcgaggcggacaacgatgtcgccatggcg
cgcatccagggcgaattccgccgcgtgatcctggccgagaagccggacgcgaagctgccg
ttctga

DBGET integrated database retrieval system