KEGG   Ralstonia solanacearum PSI07: RPSI07_2673Help
Entry
RPSI07_2673       CDS       T01273                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit PyrB (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rsl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rsl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2801374..2802345)
Genome map
AA seq 323 aa AA seqDB search
MTKTFANPQLTKNGELKHLLSIEGLSRDILTHILDTAKQFVSVSDADREVKKVPLLRGKS
VFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKGESLLDTINNLSAMQADMFVV
RHASSGAPYLIAEHVAPHVHVINAGDGRHAHPTQGLLDMFTIRHYKKDFSNLTVAIVGDI
LHSRVARSDIHALTTLGCAEVRAIGPRTLLPSGLEHMGVRVFHNMEEGLKGVDAVIMLRL
QNERMSGALLPSAQEYFKAYGLTQERLALAKPDAIVMHPGPMNRGVEIDSAVADGVQSVI
LNQVTFGIAVRMAVMGIVAGNND
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagactttcgccaacccgcagctcacaaagaacggcgagctcaagcacctgctg
tcgatcgaggggctgtcgcgtgacatcctcacgcacatcctcgatacggccaagcagttc
gtctcggtgtcggatgccgaccgcgaggtgaaaaaggtgccgctgctgcgcggcaagagc
gtgttcaacctgttcttcgagaactccacgcgcacgcgcaccacgttcgagatcgcggcc
aagcggctgtcggcggatgtgatcaacctgaacatcaacgcctcgtccaccagcaagggc
gagtcgctgctcgacaccatcaacaacctgtcggcgatgcaggccgacatgttcgtcgtg
cgccacgccagctcgggtgcgccgtacctgatcgccgagcatgttgcaccgcacgtgcac
gtgatcaacgcgggcgacggccgccatgcgcatcccacgcaggggctgctcgacatgttc
accatccgtcactacaagaaggatttctccaacctgacggtggcgatcgtcggcgacatc
ctgcactcgcgggtggcgcgctccgatatccatgcgctgaccacgctgggctgcgccgag
gtgcgcgccatcggcccgcgcacgctgctgccctccggcctggagcacatgggtgtgcgc
gtcttccacaacatggaggagggcctcaagggcgtcgacgcggtcatcatgctgcgcttg
cagaacgagcggatgagcggcgcgctgctgccgtccgcgcaggagtatttcaaggcgtac
ggcctcacgcaggagcggctggcgctggccaagccggatgccatcgtgatgcacccgggt
ccgatgaaccgcggcgtggagatcgactccgccgtggccgacggcgtgcaatcggtgatc
ctgaaccaggtgacgttcggtattgccgtacggatggcggtgatgggcatcgtggctggc
aacaacgactaa

DBGET integrated database retrieval system