KEGG   Ralstonia solanacearum PSI07: RPSI07_2825Help
Entry
RPSI07_2825       CDS       T01273                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase (Fatty acid oxidation complex subunit beta) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (Acyl-CoA ligase) (ACSs)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_2825 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_2825 (fadI)
   00640 Propanoate metabolism
    RPSI07_2825 (fadI)
   00650 Butanoate metabolism
    RPSI07_2825 (fadI)
  Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_2825 (fadI)
   00072 Synthesis and degradation of ketone bodies
    RPSI07_2825 (fadI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_2825 (fadI)
   00310 Lysine degradation
    RPSI07_2825 (fadI)
   00380 Tryptophan metabolism
    RPSI07_2825 (fadI)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RPSI07_2825 (fadI)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPSI07_2825 (fadI)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPSI07_2825 (fadI)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RPSI07_2825 (fadI)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPSI07_2825 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2954020..2955339
Genome map
AA seq 439 aa AA seqDB search
MLVNAQVRRVAILGGNRIPFARANTAYATVSNQQMLTAALQGLVDRFNLHGQRLDEVVAG
AVIKHARDFNLTRESVLSTTLARQTPAYDVQQACGTGLEAAILVANKIALGQIDVGIAGG
TDTASDAPIGLNEKMRKVLLEANRAKSTTARLKALAGLRPSMFVRPLLPRNSEPRTGLSM
GEHCEQMAKRWGIRREDQDALALRSHQNLGAAYARGFFTDLMTAHLGLDRDNNLRPNLTL
DQLAKLQPAFDRGPTGTLTAGNSTPLTDGASCVLLASEDWASAHDLSVLAYMTCADTAAV
DFFSGTPEQNEGLLMAPAYAVSRMLQRAGLALQDFDYYEIHEAFAAQVLCTLAAWESADY
CREQLGRTAPLGSIDRSRLNVNGSSLSTGHPFAATGARIVASLAKLLAQRGSGRGLVSIC
AAGGQGVVAILERPEHMHG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcaacgcgcaagtccgccgcgtcgccatcctgggcggcaaccgcatcccgttc
gcccgcgccaacaccgcctacgcgaccgtgtcgaaccagcagatgctgaccgccgcgctg
cagggcctggtcgaccgcttcaacctgcacggccagcggctggacgaggtggtggccggc
gccgtcatcaagcacgcgcgcgatttcaacctgacgcgcgagtcggtgctgtccaccacg
ctcgccaggcagacgcccgcctacgatgtgcagcaggcctgcggcaccgggctggaggcc
gccatcctggtcgccaacaagatcgcgctgggacagatcgacgtgggcatcgccggcggc
accgatacggcctccgatgcccccatcggcctgaacgaaaagatgcgcaaggtgctgctg
gaggccaatcgcgccaagtccaccaccgcgcggctgaaagcgctggccgggctgcggccg
tcgatgttcgtgcggccgctgctgccgcgcaacagcgagccgcgcaccggcctgtcgatg
ggcgagcattgcgaacagatggccaagcgctggggcatccgccgcgaagaccaggacgcg
ctggcgctgcgcagccaccagaacctcggcgccgcctacgcgcgcggcttcttcaccgac
ctgatgaccgcccacctgggcctggaccgcgacaacaacctgcgccccaacctcacgctc
gatcagctcgccaagctgcagccggcattcgaccgcggccccaccggcacgctgaccgcc
ggcaactcgacgccgctgaccgacggcgcatcgtgcgtgctgctcgccagcgaagactgg
gcaagcgcgcacgacctgtcggtgctcgcctacatgacctgcgcggacaccgccgccgtc
gacttcttcagcggcacgcccgagcagaacgagggcctgctgatggcgccggcctatgcc
gtctcgcgcatgctgcagcgcgccggcctggccttgcaggacttcgactactacgagatc
cacgaagccttcgccgcccaggtgttgtgcacactggccgcgtgggagtccgccgactac
tgccgcgagcagctcggccgcaccgcaccgctgggcagcatcgaccgcagccggctgaac
gtgaacggcagctcgctcagcaccggccacccgtttgccgccaccggagcgcgcatcgtc
gcgtcgctggccaagctgctggcgcagcgcggcagcggacgcggcctggtatcgatctgc
gccgccggcggccagggcgtggtcgccatcctcgaacgaccggagcacatgcacggctga

DBGET integrated database retrieval system