KEGG   Ralstonia solanacearum PSI07: RPSI07_2865Help
Entry
RPSI07_2865       CDS       T01273                                 

Gene name
ruvA
Definition
subunit A of RuvABC Holliday junction resolvasome, regulatory subunit (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RPSI07_2865 (ruvA)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RPSI07_2865 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2998365..2998853
Genome map
AA seq 162 aa AA seqDB search
MSTFYNLPATGEKVVLLTQQIVREDAHLLYGFGTAAERETFRQLIKISGIGARIALAVLS
GMSVAELAQAVTLQEAGRLTRIPGIGKKTAERLLLELKGKLGADLGAVPGGPAMSDDAVD
VLNALLALGYSDKEAALAIKQVPTGTGVSEGIKLALKALSKG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttctacaacctgcccgccaccggcgagaaggtcgtgctgctcacccagcag
atcgtgcgcgaggatgcgcacctgctgtacggcttcggcaccgccgccgagcgtgagacc
ttccgccaactcatcaagatctccggcatcggcgcgcgcatcgcactggcggtgctgtcg
ggcatgtcggtggccgaactggcgcaggccgtgacactgcaggaagccgggcggctgacg
cgcattcccggcatcggcaagaagactgccgagcgtctgctgctcgaactcaagggcaag
ctcggcgccgacctcggtgcggtccccggcggcccggccatgtcggacgacgcggtcgat
gtgctcaacgctctgctggcgctggggtattccgacaaggaagccgcgctggccatcaag
caggtgccgaccggcaccggcgtgtccgaaggcatcaagctggcgctcaaggccctctcc
aagggctga

DBGET integrated database retrieval system