KEGG   Ralstonia solanacearum PSI07: RPSI07_3056Help
Entry
RPSI07_3056       CDS       T01273                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_3056 (gpmA)
   01230 Biosynthesis of amino acids
    RPSI07_3056 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_3056 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    RPSI07_3056 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_3056 (gpmA)
Enzymes [BR:rsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RPSI07_3056 (gpmA)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RPSI07_3056 (gpmA)
  Exosomal proteins of melanoma cells
   RPSI07_3056 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3185192..3185947
Genome map
AA seq 251 aa AA seqDB search
MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGIAQARQGGRLLREAGFTFDLAYTSV
LKRAIRTLWHVQDEMDLMWIPTRTEWRLNERHYGGLSGLNKAETAAQYGDEQVLVWRRSY
DTPPPALEVGDERDAYGDPRYAGLSREQVPLTECLKDTVARVLPLWETAIAPDIKRGKRV
VIAAHGNSIRALVKYLDNISDNDIVGLNIPNGTPLVYELDANLKPIRHYYLGDQEAIAAS
LAAVASQGKAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcatgcataagctcgtcctcatccgccacggcgaatcgacgtggaacctcgaa
aaccgcttcaccggctgggtcgacgtcgacctgaccgacaccggcatcgcccaggcccgc
caaggcggccgcctgctgcgcgaagccggcttcaccttcgacctggcgtatacctcggtg
ctcaagcgcgccatccgcacgctgtggcacgtgcaggatgaaatggacctgatgtggatc
ccgacccgcaccgaatggcggctcaacgagcgccactatggcggcctgtcgggcctgaac
aaggccgagaccgccgcccagtacggcgacgagcaggtgctggtctggcgccgcagctat
gacaccccgccgcccgcactggaagtcggcgacgagcgcgacgcgtacggcgacccgcgc
tatgcgggcctgtcgcgcgaacaggtgccgctcaccgaatgcctgaaggacaccgtggca
cgcgtgctgccgctgtgggaaacagcgatcgccccggacatcaagcgcggcaagcgcgtc
gtgatcgccgcgcacggcaacagcatccgcgccctggtgaagtacctggacaacatctcg
gacaacgacatcgtcggcctgaacatccccaacggcacgccgctcgtctatgagctggac
gccaacctgaagcccatccgccactactatctcggcgaccaggaagcgatcgccgcgtcg
ctcgccgccgtggcgagccagggcaaagcgaaataa

DBGET integrated database retrieval system