KEGG   Ralstonia solanacearum PSI07: RPSI07_3103Help
Entry
RPSI07_3103       CDS       T01273                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RPSI07_3103
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RPSI07_3103
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RPSI07_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3232329..3233030
Genome map
AA seq 233 aa AA seqDB search
MLSPSIATPPLARARDRLTRRHAAGVLRRHHLLIIAIAIVIAIIALLLPRTGHAAAGTQA
APAPQPTAAGKCPTALDFRVRRLQDDAPQDLCQYTGRVVLVVNTASYCGYTYQYEGLEAL
YAKYRDKGLTVLGFPSNDFEQEPGTGKQIADFCYNTYGVKFPMFSKTSVVGPAASPLYHW
LTQQTGQPPKWNFHKYLLDRSGRVVAVYPSKVEPGDPALVKRIDALLAEPEPH
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgccttccatcgccacgccgccccttgcccgcgcacgcgaccggctcacccgc
cggcacgctgcgggcgtgctgcgccggcatcacctgctgatcatcgcgatcgccatcgtc
atcgcgatcatcgcgctgctgctgccgcgcaccggccacgcggccgccggcacccaggcc
gccccggcaccgcagcccaccgctgcgggcaaatgcccgaccgccctcgatttccgcgtc
aggcgcctgcaggacgacgcgccgcaggacctgtgccagtacaccggccgcgtggtgctg
gtggtcaacaccgccagctattgcggctacacctaccagtacgaagggctcgaagcgctg
tacgccaagtaccgcgacaagggcctgaccgtgctgggcttcccctccaacgacttcgag
caggagccgggcaccggcaagcagatcgccgacttctgctacaacacgtacggcgtgaag
ttcccgatgttctcgaagacatcggtggtggggccggcggcgtcgccgctctaccattgg
ctcacccagcagaccgggcaaccgcccaagtggaacttccacaagtacctgctggaccgc
agcggccgcgtggtggcggtgtatccgagcaaggtcgagccgggcgatccggccctcgtc
aaacgcatcgacgccctgctcgccgagcccgagccccactga

DBGET integrated database retrieval system