KEGG   Ralstonia solanacearum PSI07: RPSI07_3279Help
Entry
RPSI07_3279       CDS       T01273                                 

Definition
alkaline phosphatase signal peptide protein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPSI07_3279
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RPSI07_3279
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPSI07_3279
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RPSI07_3279
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RPSI07_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3408307..3409701)
Genome map
AA seq 464 aa AA seqDB search
MTKQSNRILRAGALALAAGAALPAHAAGEARNVIFFLGDGMGPTTVTAARIYKAGEAGQL
TMESLKRTARIKTYSNDAQTTDSAPSMSAYMTGVKMNNEVISMSADTKASDSTGKGYVSG
ADSTCPAGNGTPATTLLELAKAAGKSVGAVTTTRVTHATPAATYSHICHRDGENQIAAQG
APGNALYNAALKDGLDVLLGGGRRHFLPQGATGSKRTDTTDLIAQFQAASYTYVSTGTQL
AAVDPTATTKLLGLFNLDHMSYELDRVKKSVDEPSLADMTEKAIRILQKNGNGYFLMVEG
GRIDHALHGTNAKRALEDTVAFDEAIKRALSLVDRSNTLIVVTADHDHTMTINGYAHRGN
PILGLSTDIKTRQPQLAADGLPYTTLVFGNGGTTRKATRDNLAAVDTTADDYLQDVGVQL
GTPGSETHGGGDVMLFSSGPGSTPLKGTLDNTRVFGAVRSAMGL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaatcgaaccgcatcctccgtgccggcgcgctcgcgctggcggcgggcgcc
gcgctcccggcccacgcggccggcgaggccaggaacgtgatcttcttcctgggcgacggc
atgggcccgaccaccgtcaccgccgcgcgcatctacaaggcgggcgaggccggccagctg
acgatggagtcgctcaagcgcaccgcgcgcatcaagacctactccaacgacgcgcagacc
accgacagcgccccgtcgatgtccgcctacatgaccggcgtgaagatgaacaacgaagtc
atctcgatgtcggccgacaccaaggccagcgacagcaccggcaagggctatgtcagcggt
gccgacagcacttgccccgccggcaacggcaccccggcgaccacgctgctggagctggcc
aaggctgccggcaagtcggtgggcgcggtgaccaccacgcgcgtcacgcatgccacgccg
gccgccacgtattcgcatatctgccaccgcgacggcgagaaccagatcgccgcgcagggc
gcgccgggcaacgcgctgtacaacgccgcgctgaaggacggcctggacgtgctgctgggc
ggcggccgccgccacttcctgccgcagggcgcgaccggcagcaagcgcaccgataccacc
gacctgatcgcccagttccaggccgccagctacacctacgtgtccaccggcacgcagctg
gcggcggtcgacccgaccgcgaccaccaagctgctcggcctgttcaacctcgaccacatg
agctacgagctggaccgcgtgaagaagagcgtggacgagcccagcctggccgacatgacg
gagaaggccatccgcatcctgcagaagaacggcaatggctacttcctgatggtcgagggc
ggccgcatcgaccacgcgctgcacggcaccaatgccaagcgcgcgctggaagacaccgtc
gccttcgacgaggccatcaagcgcgcgctgtcgctggtggaccgcagcaacacgctgatc
gtcgtcacggccgaccacgaccacaccatgacgatcaacggctacgcgcatcgcggcaac
ccgatcctcgggctgtccaccgacatcaagacccggcagccgcagctggccgccgacggc
ctgccctacaccaccctggtgttcggcaacggcggcaccacgcgcaaggcgacgcgcgac
aacctcgcggcggtcgataccacggcggacgattacttgcaggatgtcggcgtgcagctt
ggcacccccggctcggaaacgcacggcggcggcgacgtgatgctgttctcctctggccct
ggcagcacgccgctgaagggtacgctggacaacacgagggtgttcggcgcggtcaggtcg
gccatgggcctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system