KEGG   Ralstonia solanacearum PSI07: RPSI07_3279Help
Entry
RPSI07_3279       CDS       T01273                                 

Definition
alkaline phosphatase signal peptide protein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rsl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3408307..3409701)
Genome map
AA seq 464 aa AA seqDB search
MTKQSNRILRAGALALAAGAALPAHAAGEARNVIFFLGDGMGPTTVTAARIYKAGEAGQL
TMESLKRTARIKTYSNDAQTTDSAPSMSAYMTGVKMNNEVISMSADTKASDSTGKGYVSG
ADSTCPAGNGTPATTLLELAKAAGKSVGAVTTTRVTHATPAATYSHICHRDGENQIAAQG
APGNALYNAALKDGLDVLLGGGRRHFLPQGATGSKRTDTTDLIAQFQAASYTYVSTGTQL
AAVDPTATTKLLGLFNLDHMSYELDRVKKSVDEPSLADMTEKAIRILQKNGNGYFLMVEG
GRIDHALHGTNAKRALEDTVAFDEAIKRALSLVDRSNTLIVVTADHDHTMTINGYAHRGN
PILGLSTDIKTRQPQLAADGLPYTTLVFGNGGTTRKATRDNLAAVDTTADDYLQDVGVQL
GTPGSETHGGGDVMLFSSGPGSTPLKGTLDNTRVFGAVRSAMGL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaatcgaaccgcatcctccgtgccggcgcgctcgcgctggcggcgggcgcc
gcgctcccggcccacgcggccggcgaggccaggaacgtgatcttcttcctgggcgacggc
atgggcccgaccaccgtcaccgccgcgcgcatctacaaggcgggcgaggccggccagctg
acgatggagtcgctcaagcgcaccgcgcgcatcaagacctactccaacgacgcgcagacc
accgacagcgccccgtcgatgtccgcctacatgaccggcgtgaagatgaacaacgaagtc
atctcgatgtcggccgacaccaaggccagcgacagcaccggcaagggctatgtcagcggt
gccgacagcacttgccccgccggcaacggcaccccggcgaccacgctgctggagctggcc
aaggctgccggcaagtcggtgggcgcggtgaccaccacgcgcgtcacgcatgccacgccg
gccgccacgtattcgcatatctgccaccgcgacggcgagaaccagatcgccgcgcagggc
gcgccgggcaacgcgctgtacaacgccgcgctgaaggacggcctggacgtgctgctgggc
ggcggccgccgccacttcctgccgcagggcgcgaccggcagcaagcgcaccgataccacc
gacctgatcgcccagttccaggccgccagctacacctacgtgtccaccggcacgcagctg
gcggcggtcgacccgaccgcgaccaccaagctgctcggcctgttcaacctcgaccacatg
agctacgagctggaccgcgtgaagaagagcgtggacgagcccagcctggccgacatgacg
gagaaggccatccgcatcctgcagaagaacggcaatggctacttcctgatggtcgagggc
ggccgcatcgaccacgcgctgcacggcaccaatgccaagcgcgcgctggaagacaccgtc
gccttcgacgaggccatcaagcgcgcgctgtcgctggtggaccgcagcaacacgctgatc
gtcgtcacggccgaccacgaccacaccatgacgatcaacggctacgcgcatcgcggcaac
ccgatcctcgggctgtccaccgacatcaagacccggcagccgcagctggccgccgacggc
ctgccctacaccaccctggtgttcggcaacggcggcaccacgcgcaaggcgacgcgcgac
aacctcgcggcggtcgataccacggcggacgattacttgcaggatgtcggcgtgcagctt
ggcacccccggctcggaaacgcacggcggcggcgacgtgatgctgttctcctctggccct
ggcagcacgccgctgaagggtacgctggacaacacgagggtgttcggcgcggtcaggtcg
gccatgggcctctga

DBGET integrated database retrieval system