KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0007Help
Entry
RPSI07_mp0007     CDS       T01273                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00040  Pentose and glucuronate interconversions
rsl00052  Galactose metabolism
rsl00500  Starch and sucrose metabolism
rsl00520  Amino sugar and nucleotide sugar metabolism
rsl01100  Metabolic pathways
rsl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPSI07_mp0007 (galU)
   00052 Galactose metabolism
    RPSI07_mp0007 (galU)
   00500 Starch and sucrose metabolism
    RPSI07_mp0007 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RPSI07_mp0007 (galU)
Enzymes [BR:rsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPSI07_mp0007 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: CBJ34367
UniProt: D8MYF0
Position
mpPSI07:5949..6914
Genome map
AA seq 321 aa AA seqDB search
MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGR
AKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYVRQPETLGLGHAVLCAQ
KLVRDEPFAVILADDLLDHEPPVMRQMTELYDHYRCSIVGVETIAPQASRSYGVVAGREW
DDRLIKLDGIVEKPAPERAPSNLGVVGRYILTPRIFDHLRNLAPGAGGEIQLTDAIQSLM
TEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGAEFEAYLYARMGLPRELPAAAE
APVSTVTPVRKAVPPLVEVAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaagatcaccaaggccgtgttccccgtggcggggctcggcacacgtttcctg
cccgccacgaaagccagtccgaaggaaatgctgcccatcgtggacaagccgctgatccag
tatgcggtggaggaagccgccgcggcaggcattaccgagatgatctttatcaccgggcgt
gccaagcgcgcgatcgaagaccatttcgacaaggcctacgaactggagtccgaactggct
gcgaagaacaagcatgcgctgctagagatggtccagtccatcaagccggccggcgtcgaa
tgcttctatgtgcgccagccggagacgctgggcctgggccacgccgtgctgtgcgcacag
aaactggtacgcgacgaacctttcgccgtgatcctggccgacgatctgctcgaccatgag
ccaccggtcatgcggcagatgacggagctctacgaccactaccgctgctcgatcgtcggg
gtggagaccatcgcgccgcaggcgtcgcgttcatacggcgtggtagcggggcgtgaatgg
gacgatcggctgatcaagctggacggcatcgtcgaaaagccggcgccggagcgggcgcca
tccaacctcggggtggtcggtcgctatatcctgacgccgcgcatcttcgaccatctgcgg
aatcttgcgcctggcgcgggtggcgagatccagctcacggacgcgatccagagcctgatg
acagaggagcagatcctggcgtaccggtatcgcgggcagcgcttcgattgcggcagcaag
ttcggctatctgcaggccaccgtcgagttggcgctgcgccatccggaggttggcgcggaa
ttcgaggcttatctgtatgcgcggatgggcctgccgcgtgagttgcccgctgctgcggag
gcacccgtgagcaccgtcaccccggtccgcaaggcggtgccgccactggtggaggtggct
gcctga

DBGET integrated database retrieval system