KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0007Help
Entry
RPSI07_mp0007     CDS       T01273                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPSI07_mp0007 (galU)
   00052 Galactose metabolism
    RPSI07_mp0007 (galU)
   00500 Starch and sucrose metabolism
    RPSI07_mp0007 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    RPSI07_mp0007 (galU)
Enzymes [BR:rsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RPSI07_mp0007 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:5949..6914
Genome map
AA seq 321 aa AA seqDB search
MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFITGR
AKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYVRQPETLGLGHAVLCAQ
KLVRDEPFAVILADDLLDHEPPVMRQMTELYDHYRCSIVGVETIAPQASRSYGVVAGREW
DDRLIKLDGIVEKPAPERAPSNLGVVGRYILTPRIFDHLRNLAPGAGGEIQLTDAIQSLM
TEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGAEFEAYLYARMGLPRELPAAAE
APVSTVTPVRKAVPPLVEVAA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaagatcaccaaggccgtgttccccgtggcggggctcggcacacgtttcctg
cccgccacgaaagccagtccgaaggaaatgctgcccatcgtggacaagccgctgatccag
tatgcggtggaggaagccgccgcggcaggcattaccgagatgatctttatcaccgggcgt
gccaagcgcgcgatcgaagaccatttcgacaaggcctacgaactggagtccgaactggct
gcgaagaacaagcatgcgctgctagagatggtccagtccatcaagccggccggcgtcgaa
tgcttctatgtgcgccagccggagacgctgggcctgggccacgccgtgctgtgcgcacag
aaactggtacgcgacgaacctttcgccgtgatcctggccgacgatctgctcgaccatgag
ccaccggtcatgcggcagatgacggagctctacgaccactaccgctgctcgatcgtcggg
gtggagaccatcgcgccgcaggcgtcgcgttcatacggcgtggtagcggggcgtgaatgg
gacgatcggctgatcaagctggacggcatcgtcgaaaagccggcgccggagcgggcgcca
tccaacctcggggtggtcggtcgctatatcctgacgccgcgcatcttcgaccatctgcgg
aatcttgcgcctggcgcgggtggcgagatccagctcacggacgcgatccagagcctgatg
acagaggagcagatcctggcgtaccggtatcgcgggcagcgcttcgattgcggcagcaag
ttcggctatctgcaggccaccgtcgagttggcgctgcgccatccggaggttggcgcggaa
ttcgaggcttatctgtatgcgcggatgggcctgccgcgtgagttgcccgctgctgcggag
gcacccgtgagcaccgtcaccccggtccgcaaggcggtgccgccactggtggaggtggct
gcctga

DBGET integrated database retrieval system