KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0104Help
Entry
RPSI07_mp0104     CDS       T01273                                 

Gene name
pme
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RPSI07_mp0104 (pme)
   00500 Starch and sucrose metabolism
    RPSI07_mp0104 (pme)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     RPSI07_mp0104 (pme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(117051..118247)
Genome map
AA seq 398 aa AA seqDB search
MHTKTLYLKAAAFLFLGGSPLVAATALAATSTATRPQLSNADARAYTIASYMASFGTIGS
LTTDNWDPTSGVGAVSGFRANYAVAADGTAQYRTVQAAIDAAVAAGGVARKYISVKAGTY
NELVCVPTSAPPITLYGLDANASNTVIVYNNANPTPASGAKTNPCMGASSTATVGTLRSA
TAMVRASDFHARDLTFKNGYAEGTYADNNQSAVALAVRGDKAILENISVTGNQDTLYVGA
TDTTTVIRAYFKNSFIQGDTDFIFGAGTAVFHGCTIQYTAARLGAGATSYIFAPSTAPNN
PHGFLAINSTFNATAGASNNSTYLGRAWDQSVSGTSAYVNGSSPNGQVVIRDSSLGAHIR
LANPWGPSTAGRPYCSANCAYSANRFFEYNNTGAGSGN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaaaaaccctgtatttgaaggccgccgcatttctgtttctcggaggcagcccc
ctggttgccgcaacggcgcttgccgcgacgagcacggccacacgcccgcagctcagcaat
gccgatgcgcgggcctacacgatcgccagctacatggcgagcttcgggaccatcggctcg
ctgaccaccgacaactgggaccccaccagcggtgtcggcgcggtgagcggcttccgggcc
aactatgcggtcgccgcggacggaacggcgcagtacaggacggtgcaggccgcgatcgat
gcggcagtcgctgccggcggcgtggcacgcaagtacatcagcgtgaaggccggcacctac
aacgaactggtctgcgtgcccacgtcggcgcctcccatcacgctgtatgggctcgatgcc
aatgccagcaatacggtgatcgtctacaacaacgcgaacccgacacccgcctcaggcgcc
aagacgaacccctgcatgggcgccagcagcaccgcgacggtcggcacgctgcgcagcgcc
accgccatggtgcgggcctcggacttccacgcccgtgacctgacattcaagaacggttac
gcggaaggcacctatgccgacaacaatcagtccgcggtggcactcgccgtgcgtggcgac
aaggcgatcctcgagaacatctcggtcaccggcaaccaggacacgctgtatgtcggcgcg
acggacaccaccacggtgatccgcgcctacttcaagaacagcttcatccagggcgatacg
gacttcatcttcggcgccggcaccgccgtcttccacggctgcacgatccagtacacggca
gcgcgcctcggcgccggcgccaccagctacatcttcgcgccgagcacggccccgaacaac
ccgcacgggttccttgccatcaacagcacgttcaacgccaccgcaggcgcgtcgaacaac
agtacctacctgggacgcgcgtgggatcagagcgtgagtggcacgtcggcctatgtcaac
ggcagctcgcccaatgggcaggtggtgatccgcgattcgtctctcggcgcgcatatccgg
ctggccaacccgtggggcccatcgacggcggggcggccttattgttcggccaactgtgcg
tactcggcgaatcggttctttgaatacaacaatacgggggcgggtagcgggaactga

DBGET integrated database retrieval system