KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0109Help
Entry
RPSI07_mp0109     CDS       T01273                                 

Gene name
egl
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPSI07_mp0109 (egl)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RPSI07_mp0109 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:123850..125118
Genome map
AA seq 422 aa AA seqDB search
MPLVAASVAAFMLAGCGGGDGDTSLSTASASGTDTTTLKTAATTSISPLWLTVANDGAAF
TVSGTRTVRYGTGTTWVGKSMSGTGQCTAAFFGKDPAAGVAKVCQVAQAKGTLLWRGVSL
AGAEFGEGSLPGTYGSNYIYPSADSATYYKNKGMNLVRLPFRWERLQPTLNQPFDPNELL
RLTGFVDTVTAAGQTVLLDPHNYARYYGNVIGSSAVPNSAYADFWRRLATQFKGNARVIF
GLMNEPNSMPTEQWLSGANAALAAIRSANANNVVFVPGNAWTGAHSWNQNWYGTPNGTVM
KGINDPGRNLVFEVHQYLDGDSSGQSASCVSATIGAERLQDFTNWLRSNGYRGFLGEFGA
ASNDTCNQAVANMLTFVKNNADVWTGWAWWAGGPWWGSYMYSIEPSNGVDKPQMSVLAPY
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggtcgccgcttcggtggcggccttcatgctcgccggttgcggcggcggtgac
ggcgataccagtttgagcaccgcgagcgcttccggcaccgacaccacgaccctgaagacg
gccgccaccacctcgatctcgccgttgtggctcaccgtcgccaacgacggcgcggcgttt
acggtgagcggcacgcgcacggtgcgctatggcaccggcaccacgtgggtaggaaagagc
atgtccggcacaggccagtgcaccgccgccttcttcggcaaggatcccgcggccggtgtc
gccaaggtatgccaggtggcgcaggccaagggcaccctgctgtggcgcggcgtcagcctg
gccggcgccgagttcggggagggcagcctgccggggacctatggcagcaactacatctat
ccgtccgccgacagcgcgacgtactacaagaacaagggcatgaacctggtgcgcctgccg
ttccggtgggagcggctgcagcccacgctcaaccagccgttcgatccgaacgaactgttg
cgcctgaccgggtttgtcgacacggtgacggccgccggccagacggtgctgctcgatccg
cacaattacgcgcgctattacggcaacgtgatcgggtcgagcgcggtgcccaacagcgcg
tacgcggatttctggcggcgcctggcgacccagttcaagggcaatgcgcgcgtcatcttc
gggctgatgaacgagcccaattcgatgccgaccgagcagtggctgtccggcgccaacgcc
gcgctggccgcgatccgctcggccaacgcgaacaacgtggtgttcgtgcccggcaacgca
tggacgggcgcgcacagctggaaccagaattggtacggcacgccgaacggcaccgtcatg
aagggcatcaatgacccgggccgcaacctcgtcttcgaggtgcaccagtacctggacggc
gattcgtccggccagtcggccagctgcgtgagcgccaccatcggcgccgagcggctgcag
gactttaccaactggctgcgcagcaacggctaccgcggcttcctgggcgagttcggtgcg
gcctccaacgacacctgcaaccaggcggtcgccaacatgctcaccttcgtgaagaacaac
gccgatgtctggacgggctgggcgtggtgggcgggcggtccgtggtggggcagctatatg
tactcgatcgagccgtcgaacggcgtggacaagccgcagatgtcggtgctggcgccctac
ctgaagtaa

DBGET integrated database retrieval system