KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0509Help
Entry
RPSI07_mp0509     CDS       T01273                                 

Definition
magnesium chelatase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPSI07_mp0509
Enzymes [BR:rsl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RPSI07_mp0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(655636..657540)
Genome map
AA seq 634 aa AA seqDB search
MKHPYPFSAIVGQEQLKRALLLCAIDPTLGGVLIRGDKGTAKSTAARGLTDVLPPITRVA
GCAFNCAPDAPLAECEACQSGNAAHASAPVPFVNLPLGATEDRVLGHLDIERALKDGRKA
FQPGLLAAAHRGLLYIDEVNLLPDHLVDVLLDVSAMGHNTVEREGLAMRHPARITLLGTM
NLEEGDLRPQLLDRFGLMVEVTAPRDAAVRTEVVRRRLAFEADPASFAAAWQADTDALRA
RLAAAQAMLAQVTLPDTLFAFVSTLCCEFEVASLRADIVMHKAARALAALDGRPEVTAED
VRDAAELVLPHRRRRKPFEQSGLDRERLDELMRQAAPPPPQSTGTEMDAAPSEDHSGDTA
PADGAAEQVFAAGPAATVGRIEVTARQAHDAGGRRSLATGTRRGHAIGAVPNEAPSRLAV
DATLRHALLRNPADFSVTRADLHEKVHAGRQGNLILLVADASGSMAARRRMEMVKASVLG
LLQDAYQRRDQVALICFRGEQAELVLPPTRQVELAERALAALPTGGRTPLAHALQLAAQT
LAQPSDLTPLLVVISDGRANIALDAEQDPWREALALAGHLAARGTPALVLDTEQDYVRLG
RARELAQALQADCLPLDHLSGEQLTLTIRERVRG
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacccctacccattcagcgccatcgtcggccaggaacagctcaagcgcgccctg
ctgctgtgcgcgatcgacccgaccctgggcggcgtgctgatccgcggcgacaagggcacc
gccaagagcaccgccgcgcgcggcctgaccgacgtgctgccgcccatcacgcgggtggcc
ggctgcgccttcaactgcgcaccggacgcgccgctggccgaatgcgaggcctgccagtcc
ggcaacgccgcgcacgccagcgcaccggtgcccttcgtcaacctgccgctgggtgccacc
gaagaccgcgtgctcggccacctcgacatcgagcgcgcgctcaaggatggccgcaaggca
ttccagccgggcctgctggctgcggcgcaccgtggcctgctgtatatcgatgaggtcaac
ctgctgcccgaccacctggtcgacgtgctgctcgatgtgtcggccatggggcacaacacg
gtcgagcgcgaaggcctggcgatgcgccaccccgcgcgcatcacgctgctcggcaccatg
aacctcgaagaaggcgatctgcgtccgcagctgctggaccgcttcggcctcatggtggag
gtgaccgccccgcgcgatgccgccgtccggaccgaggtggtgcgccggcgcctggcgttc
gaggccgaccccgccagctttgcggcggcctggcaggccgacaccgatgcgctgcgcgcg
cggcttgccgccgcccaggcgatgctggcccaggtcacgctgcccgacacgctgttcgcc
ttcgtcagcacgctgtgctgcgagttcgaggtggcgagcctgcgcgccgatatcgtgatg
cacaaggcggcccgcgcgctcgccgcgctggacggccgccccgaagtcaccgccgaggac
gtgcgcgacgcggccgagctggtcctgccgcaccggcgccgccgcaagccgttcgagcag
tccggcctggaccgcgagcggctggacgagctgatgcggcaggccgcgccgccaccgccg
caaagcaccggcaccgagatggacgctgcgccatccgaagaccacagtggcgacaccgcg
cctgccgacggcgccgccgaacaggtcttcgccgccggcccggccgccacggtcggccgc
atcgaagtcaccgcgcggcaggcgcacgacgccggcggccggcgcagcctcgccaccggc
acgcggcgcggccacgccatcggcgcggtgccgaacgaggccccgtcccggctggcggtg
gacgcgaccctgcgccacgcgctgctgcgcaatccggccgatttcagcgtgacccgcgcc
gacctgcacgagaaggtccatgccggccgccagggcaacctgatcctgctggtggcggac
gcctccggctcgatggccgcgcgccgccgcatggagatggtcaaggccagcgtgctcggc
ctgctgcaggacgcctaccagcgccgcgaccaggtggcgctgatctgcttccgcggcgag
caagccgagctggtactgccgcccacgcgccaggtcgagctggccgagcgcgcgctcgcc
gcgctccccaccggcgggcgcacgccgctcgcccatgccctgcagctggcggcgcaaacc
ctcgcgcagccgagcgacctcacaccgctgctggtggtcatcagcgacggccgtgccaat
atcgcgctggacgcggagcaagacccgtggcgcgaggcactggcgctggccgggcacctg
gccgcgcgcggcacgccggccctggtgctggataccgagcaggactacgtccgcctgggg
cgcgcccgcgaactcgcccaggcgctgcaggccgactgcctgccgctcgatcacctgagc
ggcgagcaactgacgctgacgattcgggagcgggtacggggatga

DBGET integrated database retrieval system