KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0581Help
Entry
RPSI07_mp0581     CDS       T01273                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPSI07_mp0581 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_mp0581 (trpC)
Enzymes [BR:rsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RPSI07_mp0581 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(731478..732284)
Genome map
AA seq 268 aa AA seqDB search
MSILDAIKPSKEEEVANAKASRSLSELEQAIKQLPPPRDFVGAIAESVRNKEVALIAEIK
KASPSKGLIRSDFDVAEIAKAYRDGGAACLSVLTDQAFFQGKPADLALAKEVSGLPVLRK
DFMIDPYQIYEARAMRADCILLILAMLDHAQATELEATAQAMGMGVLIEIHDESELERAM
GMKSRLIGINNRDLTTFAADLKTSERLAPKVNGDRIVVSESGIGGREDVIRLTAAGINSF
LIGEQLMRARHIESATREITQARLHASP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttagatgccatcaaacctagcaaggaagaagaagttgccaatgctaaagcc
agtcggagtctttccgaattggaacaagcaatcaagcaactgccgccgcctcgcgatttc
gtgggtgcgatcgccgagagcgttcgcaataaagaggtggcgttgattgccgagatcaaa
aaagccagtccatccaagggactcattcgcagcgatttcgatgttgccgaaattgccaag
gcgtaccgcgatggcggtgcggcttgtttgtcggtcttgaccgatcaagccttctttcag
ggcaaaccggccgacctagcgttagcaaaggaggtgtcggggctgcctgtcctgcgcaag
gacttcatgatcgatccctaccagatctatgaagcgcgcgccatgcgggccgactgcatt
ctcttgattctggccatgctcgatcacgcgcaagcgaccgaactggaggccaccgctcag
gccatgggcatgggcgtgctgatcgaaatccatgatgagtcggagctggagcgcgcgatg
gggatgaagtcgcgactgattggcatcaacaatcgcgacctgaccaccttcgccgcggat
ctgaaaacgtccgagaggctggcccccaaggtgaacggcgaccgcatcgtcgtcagtgaa
agcggtatcggcgggcgggaggatgtgatccgcctgacggcggccggcatcaacagcttt
ctcatcggcgaacaactcatgcgggcacgtcatatcgagagcgcaacgcgtgagatcaca
caagcccgcctccacgcatcaccgtag

DBGET integrated database retrieval system