KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1092Help
Entry
RPSI07_mp1092     CDS       T01273                                 

Definition
dehydrogenase/reductase oxidoreductase protein (EC:1.-.-.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rsl00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rsl00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:1326261..1327046
Genome map
AA seq 261 aa AA seqDB search
MSDLKGKVAVVTGAASGIGKQIALTLARAGAAIGIVDLNEDGAQAVAREITDAGGKAIGL
RMDVTDEQAVDDGIDRVAAELGSVDILVSNAGIQIVNPIETYAFADWKKMQAIHVDGAFL
TTRAALRHMYKDKRGGVVIYMGSVHSHEGSPLKSAYVAAKHALLGLSKVVAKEGAAHQVR
SHVVCPGFVRTPLVDKQIPEQAKALGISEDEVVRNVMLGGTVDGVFTTVEDVAETVRFLA
SFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgaaaggaaaagtcgctgtcgtcaccggtgccgccagcggcatcggcaag
cagatcgccctcacgctcgcccgggccggcgcggccatcggcatcgtcgacctgaacgaa
gacggcgcccaggccgtcgccagggaaatcaccgacgccggcggcaaggccatcggcctg
cgcatggacgtcaccgacgaacaggccgtcgacgacggcatcgaccgcgtggcggccgaa
ctgggatcggtcgacatcctggtctccaacgccggcatccagatcgtcaacccgatcgag
acctacgcctttgccgactggaagaagatgcaggccatccacgtcgacggcgccttcctg
accacgcgggcggcgctgcgccacatgtacaaggacaagcggggtggcgtggtgatctac
atgggctcggtgcactcgcacgagggctcgccgctcaagtccgcctacgtggcggccaag
catgcgctgctggggctgtccaaggtcgtggccaaggaaggcgcggcgcatcaggtgcgc
tcgcatgtggtctgcccggggttcgtgcgcacgccgctggtcgacaagcagattcccgaa
caggccaaggcgctcggcatcagcgaggacgaggtggtgagaaacgtgatgctgggcggt
accgtggacggcgtgttcacgacggtggaagatgtggccgagaccgtgcgcttcctggcg
agcttccccagcgcggcgctgaccggccaatcgttcgtggtcagccacggctggttcatg
cagtaa

DBGET integrated database retrieval system