KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1092Help
Entry
RPSI07_mp1092     CDS       T01273                                 

Definition
dehydrogenase/reductase oxidoreductase protein (EC:1.-.-.-)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPSI07_mp1092
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPSI07_mp1092
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPSI07_mp1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:1326261..1327046
Genome map
AA seq 261 aa AA seqDB search
MSDLKGKVAVVTGAASGIGKQIALTLARAGAAIGIVDLNEDGAQAVAREITDAGGKAIGL
RMDVTDEQAVDDGIDRVAAELGSVDILVSNAGIQIVNPIETYAFADWKKMQAIHVDGAFL
TTRAALRHMYKDKRGGVVIYMGSVHSHEGSPLKSAYVAAKHALLGLSKVVAKEGAAHQVR
SHVVCPGFVRTPLVDKQIPEQAKALGISEDEVVRNVMLGGTVDGVFTTVEDVAETVRFLA
SFPSAALTGQSFVVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctgaaaggaaaagtcgctgtcgtcaccggtgccgccagcggcatcggcaag
cagatcgccctcacgctcgcccgggccggcgcggccatcggcatcgtcgacctgaacgaa
gacggcgcccaggccgtcgccagggaaatcaccgacgccggcggcaaggccatcggcctg
cgcatggacgtcaccgacgaacaggccgtcgacgacggcatcgaccgcgtggcggccgaa
ctgggatcggtcgacatcctggtctccaacgccggcatccagatcgtcaacccgatcgag
acctacgcctttgccgactggaagaagatgcaggccatccacgtcgacggcgccttcctg
accacgcgggcggcgctgcgccacatgtacaaggacaagcggggtggcgtggtgatctac
atgggctcggtgcactcgcacgagggctcgccgctcaagtccgcctacgtggcggccaag
catgcgctgctggggctgtccaaggtcgtggccaaggaaggcgcggcgcatcaggtgcgc
tcgcatgtggtctgcccggggttcgtgcgcacgccgctggtcgacaagcagattcccgaa
caggccaaggcgctcggcatcagcgaggacgaggtggtgagaaacgtgatgctgggcggt
accgtggacggcgtgttcacgacggtggaagatgtggccgagaccgtgcgcttcctggcg
agcttccccagcgcggcgctgaccggccaatcgttcgtggtcagccacggctggttcatg
cagtaa

DBGET integrated database retrieval system