KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1178Help
Entry
RPSI07_mp1178     CDS       T01273                                 

Gene name
glsA
Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00220  Arginine biosynthesis
rsl00250  Alanine, aspartate and glutamate metabolism
rsl00471  D-Glutamine and D-glutamate metabolism
rsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RPSI07_mp1178 (glsA)
   00220 Arginine biosynthesis
    RPSI07_mp1178 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RPSI07_mp1178 (glsA)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     RPSI07_mp1178 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CBJ35509
UniProt: D8N1K0
Position
mpPSI07:1444307..1445221
Genome map
AA seq 304 aa AA seqDB search
MDYQAILETIHRDIQPWLGKGRVADYIPELAKASATDFGMAIVTLRGEVFRVGQAETLFS
IQSISKLFACTLAFQLEGESLWQRVGREPSGNAFNSLVQLEHENGIPRNPFINAGALVVT
DVLCRRFVQAETAMVQFMRRLVDNPRVDYDPRVALSELEHADRNRAMAHFMRSFGNLNMP
VETVIDAYCRQCALEMNCVDLARAVLFLANGGVVPWSGERVIEASPAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEFGVCVWSPGLDVSGNSLAGLQALEWLTTLSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaagcgatcctggaaaccatccaccgcgacatccagccctggctcggcaaa
ggccgcgtggccgactacattcccgagctggccaaggccagcgccaccgatttcggcatg
gcgatcgtcaccctgcgcggcgaggtgttccgcgtcgggcaagccgagacgctgttctcc
atccagagcatttccaagctgttcgcgtgcacccttgccttccagctcgagggcgaatcg
ctgtggcagcgggtcggccgcgagccgtccggcaatgccttcaactcgctggtgcagctg
gagcacgaaaacggcatcccgcgcaatccgttcatcaacgcaggcgccctggtggtgacc
gacgtgctgtgccggcgcttcgtgcaggccgagacggccatggtgcagttcatgcggcgg
ctggtcgacaacccgcgcgtcgactacgacccgcgcgtggcgctgtccgaactcgaacat
gcggaccgcaaccgcgccatggcgcacttcatgcgcagcttcggcaacctgaacatgccg
gtcgaaacggtgatcgacgcctactgccggcagtgcgccctcgagatgaactgcgtggat
ctcgcgcgcgccgtgctgttcctggccaacggcggcgtggtgccgtggagcggcgaacgc
gtgatcgaggccagtccggccaagcgcctgtccgcgctgatgctgacctgcggcacctac
gacgcggccggcgatttcgtctaccgggtcggcctgccggccaagagcggcgtgggcggc
ggcatcgtcgcggtgctgccgggcgagttcggcgtgtgcgtgtggtcgccggggctggat
gtgagcggcaattcgctggccggcctgcaggcgctggaatggctgaccacgctgagcggg
cgctcgatcttctga

DBGET integrated database retrieval system