KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1199Help
Entry
RPSI07_mp1199     CDS       T01273                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RPSI07_mp1199
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RPSI07_mp1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:1462153..1465605
Genome map
AA seq 1150 aa AA seqDB search
MVRIATPLSEIKERYDVVVIGSGYGGGIAASRMARAGRTVCLLERGREIIPGEYPNTLVE
ATEEFQVHHPDGHIGSRTGLYDLHVNAQQNVIVGCGLGGTSLINANVALEPEPQVFEDPR
WPRHVREHADTLLKEGFARAREMLKPTPYPDAAATLPKLQANEKSASQMQAPHTFYRPPI
NVTFDDLPDNRNHVGVEQLRCNGCGDCVSGCNNKAKNTTLMNYLPDASNHGAEIFCQASV
RYLARNGHGWIVHYQYVGTGREAFDAPTLFVQADIVVLSAGTLGSTEILLRSRDQGLLLS
DELGKHMSGNGDILGFGYNNDDKINGIGFGTHSGKGIGPVGPCITSIIDMRDEKDRTQRM
VIEEGSIPGALGRTIVPAMAAASAEIGRPTETGVVARMTRAAREVESAVLGPYYGAVNRL
QTYLIMSHDNGAGTMVLDARDQLRVDWPGVGEQPNFKIGNDRLYDATRALGGTYVPNPIW
TDLFKHSLITVHPLGGCVMGEDAAQGVVNHKGQVFSGASGSDVYPGLYVTDGSVIPTSLA
VNPLLTISAVSERTMALLAEDRGWHIDYTLPSAPSKPAQPVKPGIEFTETMKGYVSLAHR
QAQGTDPAVYEAAYQAGKDAGSTMAFTVTVRSDDLDQLITNPQHQATIVGTLNAPSLSPQ
PLTVSHGVFNLFEAFPEQVGVRHMNYNMRLTAEGGKDYFFSAFKSVPSDHSVLRVWADTS
TLYVTVYAGTDNTGPVVGSGVLHIEPSDFAKQMTTMKVLNASSEAERLKDLARFGKYFAG
VLWESYGGVLAGNAYFNPDAPPRKKRPLNVGAPEVSFFQTEDNVTLRLTRFQGGSKGPVM
LVHGLGVGSNIFSTDTIATNLLECLYQHGYDVWLLDFRVSILLEASQQQCDGDQIARYDF
PAAITRIRQVTGAKDVQCVVHCYGATTFFMSLLAGLQGVRSVVCSQIATDIVVPPATAVK
TGLHIPSVLDKLGVQSLTAYTQAHADWFEKLYDTALKGYALTEAQGYCNNPVCHRITFMY
ASLYRHETLNETLHDNLHELFGVANMRTMEHLALLCRTGHLVGFGGEDIYMPHLDRLKLP
ILFISGEQNECYLPESTRRTYQQLVDRFGPERYSRLVVPGYGHIDCMFGKNAVVDVYPAI
VAHLDKTASA
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggtacgaattgcgacgccgctcagtgaaatcaaggagcgttacgacgttgtggtgatc
gggtctggctatggcggaggcattgctgcatcgcgcatggcgcgtgcgggtcgcacagtc
tgtttgctggagcgtggccgggaaatcattcccggcgagtatcccaataccctggtggag
gcaacggaagagtttcaggtccatcaccccgatggccatatcggctcacgcaccggctta
tacgatttgcacgtcaatgcccagcaaaacgtcatcgtcggctgcggcctgggtggcacc
tcgctgatcaacgccaacgtcgcgctggagcccgagccccaggtattcgaagacccgcgc
tggccccggcacgtgcgtgagcatgccgataccttgctgaaggaaggcttcgcccgggcg
cgggaaatgctcaagcccaccccttaccccgacgccgcggccaccttgcccaagctgcag
gccaacgaaaagtccgcctcgcagatgcaggcaccacacaccttctatcgcccgcccatc
aatgtcacgttcgacgacttgccggacaaccgcaatcacgtgggcgtggagcagttgcgc
tgcaacggttgcggtgactgcgtctcaggctgcaacaacaaggccaagaacaccacgctg
atgaactacctgcccgatgccagcaatcacggcgcggagattttctgccaggcatcggtc
cgctatctggcgcgcaatggtcatggctggatcgtgcactaccagtacgtcggcaccggg
agggaagcgttcgatgcgccaacgctgttcgtccaggctgacatcgtcgtgctctccgcc
ggcacgttgggctcgacggagattctgttgcgttcgcgcgatcagggcctgctgctctcc
gatgaactcggcaagcacatgagcggtaacggtgacatcctgggcttcggttacaacaac
gacgacaagatcaacggcatcgggttcggcacgcactccggcaagggcatcggcccggtg
gggccctgcatcacctccatcatcgacatgcgcgatgagaaagaccggacgcagcgcatg
gtgatcgaagaggggtcgatcccgggagccctcggtcgcaccatcgtcccggccatggcc
gccgcgtcggcagaaatcggtcggcccaccgagaccggggtggtcgccaggatgacgcgc
gctgcccgggaggtggagagcgcggtgctgggaccctactacggtgcggtcaatcgcctg
caaacctatctgatcatgagccacgacaatggcgcgggcacgatggtgctggacgcccgc
gaccaactgcgcgtcgactggcccggcgtgggcgagcagcccaatttcaagatcggcaac
gaccgcctgtatgacgccacccgtgcactgggcggcacctatgttcccaatcccatctgg
accgatctgttcaagcacagtctgatcacggtgcacccgttgggcggatgcgtgatgggc
gaggacgccgcacaaggcgtcgtcaaccacaaggggcaggtgttcagcggcgcgtccggc
agcgacgtgtatccgggtctgtatgtgaccgatggctcggtcatccccacttcactggcg
gtcaacccattgttgaccatttccgcggtcagcgagcggacgatggccttgctggcggaa
gaccggggctggcatatcgactacaccttgccgtcggcgcccagcaagccggcccagccc
gtcaaaccgggcatcgaattcaccgaaaccatgaaagggtatgtctccctggcgcaccgg
caagcgcagggcaccgatccggccgtctacgaggcggcctaccaggcaggcaaggacgcc
gggtccaccatggcttttaccgtgacggtgcgatccgatgatctggaccagttgatcacc
aatccgcagcatcaggccaccatcgtgggcacgctgaatgccccgtccctgtcgccacag
ccgctgacggtgagccatggcgtgttcaatctgtttgaggcgttcccggagcaggttggc
gtgcggcacatgaactacaacatgaggctgaccgcggaaggcggcaaggattacttcttc
agcgcgttcaagtccgtccccagcgaccacagcgtattgcgggtgtgggccgacaccagc
acgttgtatgtcacggtctacgccggcaccgacaacaccggcccggtggtgggatcgggt
gtgctgcatatcgagccgtccgacttcgccaagcagatgaccaccatgaaggtcctcaat
gcctccagcgaggcggagcgcctgaaggacctggcccgcttcggcaagtattttgccggg
gtgctgtgggagagctatggtggtgtgctggccgggaatgcctatttcaacccggatgcc
ccgccgcgcaaaaagcgcccgctcaacgtcggtgcaccggaagtctcgttcttccagacc
gaggacaacgtgacgttgcggctgacccgctttcagggcggcagcaaggggccggtgatg
ctggtgcatggcctgggggtgggctcgaacattttctcgaccgacaccatcgccaccaat
ttgctggaatgcctctaccagcacggctacgacgtctggctgctcgatttccgcgtcagc
atcctgctggaggccagccagcagcaatgcgacggcgaccagatcgcgcggtatgacttc
ccggcggccatcacccggattcgccaggttaccggggccaaagacgtgcagtgcgtggtg
cactgctacggcgccaccacgttcttcatgtccctgctggccgggctgcagggtgtgcgc
tccgtcgtgtgctcgcagattgccaccgatatcgtcgtgccgccggcgactgccgtcaaa
accgggctgcacatcccatcggtgctggacaagctcggcgtgcagtccctcaccgcctat
acccaggcccacgccgactggttcgaaaaactctatgacacggcgctgaaaggctatgca
ctgaccgaagcacaggggtattgcaacaacccggtctgccaccgcatcaccttcatgtac
gcctcgctataccgccacgaaacgctcaacgaaaccctgcacgacaacctgcatgagctg
ttcggcgtggccaacatgcgcaccatggagcatctggccctgctgtgccgaacgggccat
ctggtgggcttcggcggggaagacatctacatgccgcacctggaccggctcaagctgccc
atcctgtttatcagcggggagcagaacgaatgctatctgccggaaagcacccggcgcacc
tatcagcaactggtggaccgcttcgggccggagcggtacagccggctggtcgtgccggga
tacggccatatcgactgcatgtttggcaagaacgccgtcgtcgatgtctacccggccatt
gtggcccacctggacaaaaccgcctcggcttga

DBGET integrated database retrieval system