KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1205Help
Entry
RPSI07_mp1205     CDS       T01273                                 

Definition
cytochrome c peroxidase transmembrane protein (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RPSI07_mp1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(1472638..1473927)
Genome map
AA seq 429 aa AA seqDB search
MAVLALALAGLTACGRGELAEAQAATPPAVAPQAGGAPAYEKAFYTMMATRRPSVPAMAA
LGKALFFDPALSASGRLACASCHSPSHAYGPPNDLSVQPGGPEMNKTGVRAAPSLRYLQN
VPPFSEHFHENDGNDAEDQGPTGGYNWDGRASSTHDQARIPLLSAHEMANGTPASVVARL
RNGRHAQTFRQVFGNDILDSEDTAFRAALMALEVFQETPSEFYPYDSKYDAFLRKQASLT
PQEMRGLRLFSDPGKGNCASCHTSTIKEDGAFPAFSDFGHIAVGVPRNRQLAANADPAFY
DLGLCGPDRTDLTDRREYCGLFRTPSLRNVALRRSFFHNGAIHSLEDAVRFYAQRDTQPQ
KWYPRKPDGTIDKFDDLPPRYRANVNMEPPFGGKPGDRPVLSEADVRDIVAFLKTLTDGY
RPSRPVAKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctggcgctcgcgcttgccggcctgaccgcatgcgggcgcggcgagcttgcc
gaggcgcaggccgccacgccgcccgccgttgcaccgcaggccgggggggctccggcctac
gaaaaggccttctacacgatgatggcgacacgccgtccgtccgtgcccgccatggcggcg
ctgggcaaggcgctgttcttcgatcccgcgctgtccgcctccggccggctggcctgcgcc
agctgccacagtccgagccacgcctacgggccgcccaatgacctgtccgtccagccaggc
ggcccggagatgaacaagaccggcgtgcgcgccgcgccgtcgctgcgctatctccagaac
gtgccgccgttctccgagcacttccacgagaacgatggcaacgatgccgaagaccagggt
ccgaccggcggctacaactgggacggccgcgcctcgtccacgcacgaccaggcgcgcatc
ccactgctctccgcgcacgagatggccaacggcacgccggccagcgtggtcgccaggctg
cgcaacggccggcacgcgcagacgttccgccaggtgttcggcaacgacatcctcgacagc
gaagacaccgccttccgcgccgcgctgatggcgctcgaggtgttccaggaaacgccgtcg
gagttctatccgtacgacagcaagtacgacgccttcctgcgcaagcaggccagcctgacg
ccgcaggagatgcgcggcctgcggctgttcagcgaccccggcaagggcaactgcgcgtcg
tgccataccagcaccatcaaggaagacggtgccttcccggccttctcggatttcggccac
attgccgtcggcgtgccgcgcaaccggcaactggcggccaatgccgatccggccttctac
gacctcggcctgtgcggcccggaccggaccgacctgacggaccgccgcgagtactgcggc
ctgttccgcacgccttcgctgcgcaacgtggcgctgcgcaggtccttcttccacaatggg
gccatccactcgctggaagacgcggtgcgcttctacgcgcagcgcgatacacagccccag
aagtggtacccgcgcaagcccgacggcaccatcgacaagttcgacgatctgccgccgagg
tatcgcgccaacgtcaacatggagccgcccttcggcggcaagccgggtgaccggcccgtg
ctgtccgaggccgacgtgcgcgacatcgttgctttcctcaagacgctgaccgacggctac
cgcccgagccgtccggtggccaagcgctga

DBGET integrated database retrieval system