KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1301Help
Entry
RPSI07_mp1301     CDS       T01273                                 

Definition
(GenBank) putative o-succinylbenzoate-CoA ligase protein (acs)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00620  Pyruvate metabolism
rsl00640  Propanoate metabolism
rsl00680  Methane metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_mp1301
   00620 Pyruvate metabolism
    RPSI07_mp1301
   00640 Propanoate metabolism
    RPSI07_mp1301
  Energy metabolism
   00680 Methane metabolism
    RPSI07_mp1301
Enzymes [BR:rsl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RPSI07_mp1301
Lipid biosynthesis proteins [BR:rsl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RPSI07_mp1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBJ35628
UniProt: D8N1W6
Position
mpPSI07:complement(1587037..1588725)
Genome map
AA seq 562 aa AA seqDB search
MTSLEAFLRSRDVLLAHRDDYDSAVRHFAWPALDRFNWALDYFDSMARGNGTTALWVLDE
QGGETRLSFAQIAERSARVANHLRALGVRRGDRVMLMLGNVPALWDVMLACMKLGAVIIP
ATTLLTADDLRERIAMGEVRHVVVSTSDCVKLDAVAGTFTRIAVGADRAPAGWHRLEDAY
TASSAFTPDAPTQASDPLLLYFTSGTTSRPKLVMHTHASYPVGHLSTLYWIGLRPGDVHW
NISSPGWAKHAWSCFFAPWNAGATVFVYNYARFEAKAVLDVLCRAGVTTLCAPPTVWRLL
IQEDLAAWKPALRELIGAGEPLNPEVIERVRAAWGITIRDGYGQTETTCQIGNSPGQPVK
PGSMGRPLPGYRITLRDPDGNLADEGEICIELDPRPMALMAGYAGNADKTAEAMRGGVYH
TSDIAARDADGYLTYVGRADDVFKASDYRVSPFELESVLIEHPAIAEAAVVPSPDPLRLA
VPKAFLVLRAGHVAGPELARDILQFCRARLASYKRVRRIEFAELPKTISGKIRRVELRQR
EAARPETGRNLHEYWEDDFPAD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgttggaggcattcctgcgcagccgcgacgttctgctcgcgcatcgggacgac
tacgacagcgccgtgcgccacttcgcatggccagccctggatcgcttcaactgggcgctc
gactatttcgacagcatggcgcgcggcaacggaaccaccgcgctgtgggtgctcgacgag
cagggcggcgagacacgcctgtcgttcgcgcagatcgccgagcgttcggcgcgcgtggcc
aaccacctgcgcgcgctcggcgtgcggcgcggcgaccgcgtcatgctgatgctcggcaac
gtgccggcgctgtgggatgtgatgctcgcctgcatgaagctgggcgcggtcatcatcccc
gccaccacgctgctgacggccgatgacttgcgcgagcgcatcgccatgggcgaggtcagg
cacgtggtggtcagcacctcggattgcgtcaagctggatgcggtggcgggcaccttcacc
cgcatcgcggtcggtgcggaccgcgcgccggccggctggcatcgactggaagacgcctac
accgcgtcgtccgcgttcacacccgacgcgccaacgcaggcaagcgacccgctgctgctg
tacttcacttcgggtaccacctcgcggcccaagctggtgatgcacacgcatgcgagctat
ccggtcgggcatctgtcgaccctgtactggatcggtctgcgccccggcgacgtccactgg
aacatcagttcgcccggctgggccaagcatgcgtggagctgtttcttcgcgccatggaat
gccggcgccaccgtgttcgtctacaactacgcgcgcttcgaggccaaggcggtgctggac
gtactgtgccgcgcgggcgtgacgacgctgtgcgcgccgcccacggtctggcgcttgctg
atccaggaggacctggccgcctggaaacccgcgctgcgcgagctgatcggtgccggcgag
ccgctcaaccccgaggtgatcgaacgcgtgcgagcggcgtggggcatcaccatccgtgat
ggatacggccagaccgagaccacctgccagatcggcaacagccccggccagccggtcaag
cccggctcgatgggccgaccgctgccgggctaccgcatcacgctgcgcgatcccgatggc
aaccttgccgacgagggcgagatctgcatcgaactggacccgcgcccgatggcgctgatg
gcgggctatgccggcaacgccgacaagaccgccgaggcgatgcgcggcggggtgtaccac
acttccgacatcgcggcgcgcgatgccgacggctacctcacctatgtcggtcgcgccgac
gatgtgttcaaggcgtccgactatcgcgtgagtccgttcgagctggagagcgtgctgatc
gagcacccggccattgccgaagccgccgtggtgccgagccccgacccgctgcgcctggcc
gtgcccaaggccttcctggtgctgcgcgccggacacgtggccggcccggagctggcgcgc
gacatcctgcagttctgccgggcccggctggcgtcatacaagcgcgtgcggcgcatcgag
ttcgccgagctgcccaagaccatctcgggcaagatccgacgcgtcgaactgcgccagcgc
gaagcggcccgtccggagacgggccgcaaccttcatgaatattgggaagacgatttcccg
gccgactga

DBGET integrated database retrieval system