KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1661Help
Entry
RPSI07_mp1661     CDS       T01273                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_mp1661 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_mp1661 (glk)
   00052 Galactose metabolism
    RPSI07_mp1661 (glk)
   00500 Starch and sucrose metabolism
    RPSI07_mp1661 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RPSI07_mp1661 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RPSI07_mp1661 (glk)
   00524 Butirosin and neomycin biosynthesis
    RPSI07_mp1661 (glk)
Enzymes [BR:rsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RPSI07_mp1661 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(1939297..1940352)
Genome map
AA seq 351 aa AA seqDB search
MSIGLHEVGVGSMDDVTAYPRLVGDVGGTNARFALEMAPMRLAHIGVLAGDDYPSLEAAM
RAYLASLPPEIATAGVRHAAIGIANPVLGDQIRMTNRDWAFSTEAMRQSLGFDTLVVLND
FAALAHALPYLSAEELEQVGGGTCAADAPRALLGPGTGLGVASLLPTPDGRFIAVAGEGG
HVAFAPMNDEEVAIWRFARERFGHVSAERLISGMGLELIYEALGACFDLWQQGPAVRRAA
DITAIALGEMDDTAGDHARCRYAVDTFCAMLGTVAANLAVTLGARGGVYIGGGIVPRLGA
AFANSPFRRRFEDKGRFSGYVSAMPVYVIHSPYPGLIGLCAAMDHAVANGH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctattggtctgcatgaagtcggcgtgggcagcatggacgacgtgacggcctacccg
cgcctggtcggggatgtcggcgggaccaacgcgcgcttcgcactggagatggcgccgatg
cgactggcccatatcggcgtgctggccggcgacgactacccgtcgctggaagcggccatg
cgcgcctatctcgcctcgctgccgccggagatcgccacggcgggcgtgcggcatgcggcc
atcggcatcgccaatccggtgctgggcgaccagatccgcatgaccaaccgcgactgggcg
ttctccaccgaggcgatgcgccagtcgctgggcttcgataccttggtcgtgctcaacgat
ttcgccgcgctggcgcacgcgctgccctacctgagcgcggaggaactggaacaggtgggc
ggcggcacctgcgcggccgacgcgccgcgcgcgctgctggggccgggcacgggcctgggt
gtggcctcgctgctgccgacgccggacgggcgcttcatcgccgtcgcgggcgaggggggc
cacgtggcgtttgcgccgatgaacgacgaggaagtcgccatctggcgcttcgcacgcgag
cgcttcggccatgtctcggccgagcggctgatctcgggcatggggctggagctgatctac
gaggccctcggcgcgtgtttcgacctgtggcagcagggccccgccgtgcgccgcgctgcc
gacatcaccgccatcgccctgggcgaaatggacgacaccgccggcgaccatgcgcgctgc
cgctatgccgtcgatacgttctgcgccatgctcggcaccgtggcggccaacctggcggtc
acgctgggcgcgcggggcggggtctatatcggcggcggcatcgtgccgcggctgggcgcc
gccttcgccaactcaccgttccggaggcggttcgaggacaagggccgtttctccggctat
gtgtcggcgatgccggtgtatgtgatccattcgccgtaccccgggctgatcggcctgtgc
gcggcgatggatcacgccgtggcgaacggtcactga

DBGET integrated database retrieval system