KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1681Help
Entry
RPSI07_mp1681     CDS       T01273                                 

Definition
agmatinase (speb) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RPSI07_mp1681
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RPSI07_mp1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:1960584..1961540
Genome map
AA seq 318 aa AA seqDB search
MSTYTTAPRTGHQTLLYAQLDTDLDNLQADIAVLGMPFGTPYSAADFSNDQTNAPAAIRQ
ATDRVARAPGHYDFDIDGPLLQGRDDIRFVDCGDIVPDLAQPPGEHYARAEAAIRRIANA
GALPIVLGGDHGITTPILRGLDQQGPITLVHIDAHLDWRDSINGVKEGLSSPMRRASEMP
HVARIVQIGLRAQGSGRPEDLAAARAYGADLVTAYELHDIGMDAVLARIPDGGNYYITID
ADGLDPSTMPAVAGPAPGGLTFAQTRKLIHGLVRKGRVVGMDIVEIQPKKDINQISCITA
GRLVLNLIGATIRAGYFD
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctataccaccgcgccccgcaccggtcaccagacgctgctgtatgcgcagctg
gacaccgacctggacaacctgcaggccgacattgccgtcctgggcatgccgttcggcacg
ccgtattccgcagccgatttcagcaacgaccagaccaacgcgcccgccgcgatccggcag
gccaccgaccgggtcgcgcgtgcgcccggccactacgatttcgatatcgacggcccgctg
ctgcaaggccgcgacgacatccgctttgtcgactgcggcgacatcgtccccgacctggcg
cagccgccgggcgagcattacgcccgcgccgaagcagcgatccggcgcattgcgaacgcc
ggcgcactgcccatcgtcctggggggcgaccatggcatcaccacgccgatcctgcgcggc
ctcgaccagcaggggccgatcacgctggtgcacatcgatgcgcacctggactggcgggat
tcgatcaacggcgtgaaggagggcctgtcgagccccatgcgtcgcgcctcggagatgccg
cacgtcgcgcgcatcgtgcagatcggcctgcgcgcgcagggcagcggccgccccgaagac
ctggctgccgcgcgtgcctatggcgccgacctggtcaccgcctacgagctgcatgacatc
ggcatggacgcggtgctggcgcgcattcccgacggcggcaattactacatcaccatcgac
gcggatggattggacccgtcgaccatgccggcggtcgcgggccccgcgcccggcggcctg
acgtttgcgcagacgcgcaagctaattcacggcctggtgcgcaagggccgcgtggtcggc
atggatatcgtcgaaatccagccgaagaaggacatcaaccagatctcgtgcatcacggcc
ggccgtctggtcctgaacctgatcggcgcgaccatccgcgcgggctatttcgactga

DBGET integrated database retrieval system