KEGG   Ralstonia solanacearum PSI07: RPSI07_mp1756Help
Entry
RPSI07_mp1756     CDS       T01273                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPSI07_mp1756 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RPSI07_mp1756 (cheB)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RPSI07_mp1756 (cheB)
Two-component system [BR:rsl02022]
 CheA family
  CheA-CheYBV
   RPSI07_mp1756 (cheB)
Bacterial motility proteins [BR:rsl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RPSI07_mp1756 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
megaplasmid:complement(2048121..2049122)
Genome map
AA seq 333 aa AA seqDB search
MNIGIVNDLPLAVAALRRAIARRPEHRVLWVATDGAQAVDFCAAEPPDVVLMDLVMPRSD
GVEATRRIMASSHPCAILVVTSSVGANAWRVYEAMGAGALDAVDTPTLADGDGGAVPLLA
KIDQIGRLAERPVAPVWHASAPRRDDAVPLVAIGASAGGPAALATVLGKLPADFGAGIAI
VQHVDQAFAAGMAAWLDGQTALKVRVGVAGDQPRPGEVLMAATNDHMCVREDGTFGYTCE
PLSTPYRPSVDVFFHSVVACWQGDAIGVLLTGMGRDGAIGLKAMRARGYPTIAQDEATSA
VYGMPKAAAELGAASAILPLDRIADELAARVGK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgatttgccgctcgcggtcgctgcgctgcgccgcgccatc
gcccgccggcccgagcaccgcgtgctgtgggtggcgaccgacggcgcgcaggcggtcgat
ttctgcgccgccgagccgcccgacgtggtgctgatggacctggtcatgccgcgctccgac
ggtgtcgaggcgacgcgccgcatcatggcttccagccacccctgcgcgatcctggtggtg
accagcagcgtcggcgctaacgcgtggcgcgtgtacgaggcgatgggcgccggcgcgctg
gacgcggtcgacacgccgacactggccgacggcgatggcggcgccgtgccgctgctggcc
aagattgaccagatcggtcgcctggcggaaaggccggtcgcgccggtgtggcacgcgagc
gcgccgcgccgtgacgatgcggtaccgctggtggcgatcggcgcatcggcgggggggccc
gcggcgctggcgaccgtgctgggcaagctgccggccgatttcggcgccggcatcgccatc
gtgcagcacgtcgaccaggcgttcgcggcaggcatggcggcgtggctggacggccagacc
gcgctgaaggtccgcgtcggcgtggcaggggaccagccccggcccggcgaggtcctgatg
gcggccaccaacgaccacatgtgcgtgcgcgaagacggtacgttcggctatacctgcgag
ccgctctcgacgccttatcggccatcggtggacgtgttctttcatagcgtggtcgcgtgc
tggcagggcgacgccattggcgtgctgctgacgggcatgggccgcgacggcgcgatcggc
ctgaaggcgatgcgtgccaggggctatcccaccatcgcccaggatgaggcgaccagcgcg
gtgtatggcatgcccaaggccgccgccgagctgggggcggccagcgccatcctgccgctc
gaccggattgccgacgagctggccgcgcgcgtcgggaagtga

DBGET integrated database retrieval system