KEGG   Ralstonia solanacearum CMR15: CMR15_10521Help
Entry
CMR15_10521       CDS       T02725                                 

Definition
putative thiol:disulphide interchange protein (DsbC-like)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rsm  Ralstonia solanacearum CMR15
Brite
Enzymes [BR:rsm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CMR15_10521
Secretion system [BR:rsm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CMR15_10521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
547365..548111
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAALVVAMGAGYALTAGAAEPALDKVKASVQKALGSNAEIKGVAKSPLP
GLYEVNLGSQVVYTDATGRYVLNGDLLDTQTATNLTQERMAEINRIKWSDLPLDRAVKWV
KGNGARKVAVFSDPNCPYCHKLEQMFSQVDNITVYTFLFPILSEDSNTKAKQIWCASDRA
KAWRDWMVSKSAPGGDGSCDTPLEDNLKLGRALNVNGTPAIIFMDGSRAPGLIDAATLER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcctcggcggcgctggtcgtcgccatgggc
gcgggctacgcgctgaccgccggtgccgccgagcctgcgctggacaaggtcaaggcctcg
gtgcagaaggcgctgggatcgaacgccgagatcaagggcgtggccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcagccaggtcgtctacacggatgccaccggccgctat
gtgctcaacggcgacctgctcgatacgcagaccgccaccaacctcacgcaggagcgcatg
gccgagatcaaccgcatcaagtggtccgacctgccgctggatcgcgcggtgaagtgggtc
aagggcaacggcgcgcgcaaggtcgccgtgttctccgacccgaactgcccgtattgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgttcccg
atcctgtccgaggattccaacaccaaggccaagcagatctggtgcgcgtccgaccgtgcc
aaggcctggcgcgactggatggtgtccaagagcgccccgggtggtgacggcagttgcgac
acgccgctggaggacaacctgaagctgggccgcgcgctcaacgtcaacggcaccccggcc
atcatcttcatggacggctcgcgggcgccgggcctgatcgatgcggccacgctggaacgc
aagttcgcgtcgctgaagaagtcgtga

DBGET integrated database retrieval system