KEGG   Ralstonia solanacearum CMR15: CMR15_10927Help
Entry
CMR15_10927       CDS       T02725                                 

Definition
putative fatty acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CMR15_10927
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CMR15_10927
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CMR15_10927
Lipid biosynthesis proteins [BR:rsm01004]
 Desaturase
  First
   CMR15_10927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979415..980623
Genome map
AA seq 402 aa AA seqDB search
MTTEMNLIDSFLSFLANGTLNWAWWQILIFTLVVTHMTIASVTIFLHRCQAHRALDLHPA
AAHVFRFWLWLTTGMVTKEWAAIHRKHHAKCETEEDPHSPQTRGIRKVLLEGAELYRTEA
KNRETIQKFGHGTPNDWIEQNLYSKYTWQGVGLMLILDVLMFGTLGLTVWAVQMLWIPIH
AAGIINGLGHYWGYRNFDCEDASTNVFPWGLIIGGEELHNNHHTYATSAKFSIKWYEFDV
GWGYIRALEMVGLAKVKKVAPKARFGDVKPVDQNTLEAIIANRYDVMARYAKTVKVAYRQ
ELAKLKDARDVEYRALKPASKWFHRDEAKLGAPQREQLSQIVSDHSALHTFVEMRRDLGA
LWGRSNASREQLLHQLQEWCKRAEESGIHALQEFAVRLRRYA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacggagatgaacttgatcgactcctttctgagtttccttgccaacggcaccctg
aactgggcctggtggcagatcctgattttcacgctggtggtgacgcacatgaccatcgcc
agcgtcacgattttcctgcaccgttgccaggcgcaccgcgcgctcgacctgcacccggcc
gccgcccacgtcttccgcttctggctctggctgaccaccggcatggtcaccaaggagtgg
gctgccatccaccgcaagcaccacgccaagtgcgagaccgaagaggatccgcacagcccg
caaacgcgcggcatccgcaaggtgctgctggaaggcgccgagctgtaccgcaccgaggcc
aagaaccgcgagaccatccagaaattcggtcacggcaccccgaacgactggatcgagcag
aacctctattccaagtacacctggcagggcgtcggcctgatgctgatcctcgacgtgctg
atgttcggcacgctcggcctgactgtgtgggcggtgcagatgctgtggatcccgatccat
gctgccggcatcatcaacgggctgggtcactactggggctaccgcaacttcgactgcgaa
gatgcgtcgaccaacgtgttcccgtggggcctgatcatcggcggcgaagagctgcacaac
aatcaccacacctacgccacgtcggccaagttctcgatcaagtggtatgagttcgacgtg
ggctggggctacatccgtgcgctggagatggtgggcctggccaaggtcaagaaggtggcg
cccaaggcacgcttcggcgacgtcaagccggttgaccagaacacgctggaagccatcatc
gccaaccgctacgacgtgatggcccgctatgccaagaccgtcaaggtcgcctatcgccaa
gagctcgccaagctgaaggacgcccgtgacgtggaataccgcgcgctgaagccggccagc
aagtggttccatcgcgatgaggccaagctgggtgcgcctcagcgtgagcagctgtcgcag
atcgtgtcggatcattccgcgctgcacaccttcgtcgagatgcgccgcgacctgggtgcg
ctgtggggccgctcgaacgcctcgcgcgaacaactgctgcaccaactgcaggaatggtgc
aagcgggcggaggaaagcggcatccatgcgctgcaggaatttgccgtgcgcctgcgccgg
tacgcctga

DBGET integrated database retrieval system