KEGG   Ralstonia solanacearum CMR15: CMR15_20537Help
Entry
CMR15_20537       CDS       T02725                                 

Definition
putative aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    CMR15_20537
   01230 Biosynthesis of amino acids
    CMR15_20537
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CMR15_20537
   00290 Valine, leucine and isoleucine biosynthesis
    CMR15_20537
Enzymes [BR:rsm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CMR15_20537
    2.6.1.66  valine---pyruvate transaminase
     CMR15_20537
Amino acid related enzymes [BR:rsm01007]
 Aminotransferase (transaminase)
  Class I
   CMR15_20537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2487721..2488962
Genome map
AA seq 413 aa AA seqDB search
MKTIQKSAKLNNVCYDIRGPVLEKAKQMEEEGHQIIKLNIGNLAPFGFDAPEEIQQDMIR
NLPNSAGYSDSKGIFAARKAVMHYTQQQGIKNVTLDDIYLGNGASELIALATNALLDAGD
ELLLPAPDYPLWTAMTSLSGGTPVHYLCDESNGWMPDLDDIRAKITPNTKGIVVINPNNP
TGALYSDALLHDIIAIAREHGLVIFADEVYDKVLFDDNRHTAMASLSEDVLTVTFNSLSK
SYRSCGYRAGWMVVSGDKRPAKDYIEGLNMLSSMRLCANVPGQWAIQTALGGYQSINDLV
APGGRMRRQRDLAYELITAIPGVSCVKPKAALYMFPRLDPSVYPIDDDQTFIRQLLEEER
VLLVQGTGFNWHSPDHFRIVFLPHEDDLREAIGRIARFLERYRQRHGTGIRAA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacgatccagaaatccgccaagctcaacaacgtctgctatgacatccgcggcccc
gtgctggagaaggccaagcagatggaggaagagggccaccagatcatcaagctgaacatc
ggcaacctggccccgttcggcttcgatgccccggaagagatccagcaggacatgatccgc
aacctgcccaactcggccggctattcggattccaagggcatcttcgcggcgcgcaaggcg
gtgatgcactacacgcagcagcagggcatcaagaacgtcacactggacgacatctacctg
ggcaacggcgcctccgagctgatcgcgctggccaccaacgcgctgctcgacgccggcgac
gaactgctgctgcccgcacccgattacccgctgtggaccgccatgaccagcctgtcgggc
ggcacgccggtgcattacctgtgcgacgagtccaacggctggatgcccgacctggacgac
atccgcgccaagatcacgcccaacaccaagggcatcgtcgtcatcaacccgaacaatccg
accggcgcgctgtattcggacgcgctgctgcacgacatcatcgccattgcacgcgagcac
gggctggtgatcttcgccgacgaggtgtacgacaaggtgctgttcgacgacaaccggcac
accgccatggcctcgctgtcggaggatgtgctgactgtcacgttcaacagcctgtccaag
agctaccgctcgtgcggctaccgcgcgggctggatggtggtgtcgggcgacaagcgtccg
gccaaggactacatcgaaggcctgaacatgctgtcgtcgatgcgcctgtgcgccaatgtg
ccggggcagtgggcgatccagacggcgctgggcggctaccagagcatcaacgacctggtg
gcgccgggcggccgcatgcgtcgccagcgtgacctggcctacgaactgatcaccgccatt
cccggcgtgagctgcgtcaagccgaaggcggcgctgtacatgttcccgcgcctggatccg
tcggtgtacccgatcgacgacgatcagaccttcatccgccagttgctggaggaagagcgc
gtgctgctggtgcagggcaccggcttcaactggcattcgccggatcacttccgcatcgtc
ttcctgccgcacgaggacgacctgcgcgaggccatcggccgaattgcgcgcttcctggag
cggtaccgtcagcgtcacggtactggcattcgggccgcttag

DBGET integrated database retrieval system