KEGG   Ralstonia solanacearum CMR15: CMR15_30138Help
Entry
CMR15_30138       CDS       T02725                                 

Definition
putative pyridoxal-5'-phosphate (PLP)-dependent kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    CMR15_30138
Enzymes [BR:rsm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     CMR15_30138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2801282..2802535
Genome map
AA seq 417 aa AA seqDB search
MTLTRNTCLERDAADPIAPLRDAFALPDGVIYLDGNSLGARPRAALARAQQVIADEWGEG
LIRSWNQAGWFELPRRLGNKLAPLIGARADEVVITDTTSINLFKVLAAALRVQREDAPQR
RIIVSEAHNFPTDLYIAEGLADLLRDGYKLRLIDAPDALEAALGDDVAVTMLTHVNYKSG
HMYDMAAVSALAHRHGALAVWDLAHSAGAVPVDLHAGGADYAIGCTYKYLNGGPGSPAFV
WASPALRERFWQPLSGWWGHARPFAMASHYDAGAGIGRFLCGTQPITSMAMIECGLDIFA
QTSMTALRAKSLALTDLFIELVETRCAGYPLTLATPRDHAVRGSHVSYEHPDGFAVMQAL
IARGVIGDYREPGIMRFGFTPLYTRFVDVWDAVDVLRDVLETGAWQSAQFNERTLVT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcacccgcaacacctgcctcgaacgcgacgcggccgacccgatcgccccgctg
cgcgatgccttcgcgctgcccgacggcgtgatctacctggacggcaactcgctcggcgcc
cgcccccgtgccgcgctcgcccgcgcccaacaggtcatcgccgacgaatggggcgagggc
ctgatccgcagttggaaccaggccggctggttcgagctgccgcggcgcctgggcaacaag
ctcgccccgctgatcggcgcgcgcgcggacgaggtggtcatcaccgacaccacctcgatc
aacctgttcaaggtgctggccgccgccctgcgcgtgcagcgcgaagacgcgccgcaacgc
aggatcatcgtctcggaagcgcacaacttcccgaccgacctctacatcgccgagggcctg
gccgacctgctgcgcgacggctacaagctgcgcctgatcgatgcgccggacgcgctggaa
gccgcactgggcgacgacgtggccgtcaccatgctcacgcacgtcaactacaagagcggc
cacatgtacgacatggcagccgtctcggcattggcgcacaggcacggcgcgctggctgtc
tgggatctcgcgcactcggccggcgccgtgcccgtggacttgcacgccggcggcgccgac
tacgccatcggctgcacctacaaatacctgaacggcggcccgggctcgccggccttcgtg
tgggcctcgcccgcgctgcgcgagcgcttctggcagccgctgtcgggctggtggggccac
gcgcggccgttcgcgatggcgtcacactacgatgccggcgccggcatcgggcgcttcctg
tgcggcacccagccgatcacgtcgatggcgatgatcgaatgcgggctggacatcttcgcc
cagacctcgatgaccgcgctgcgcgccaagtcgctcgcgctgaccgatctcttcatcgaa
ctggtcgagacccgctgcgccggctacccgctgacgctcgccaccccgcgcgaccacgcg
gtgcgcggcagccacgtcagctacgagcacccggacggctttgccgtgatgcaggcgctg
atcgcgcgcggcgtgatcggcgactaccgcgagccgggcatcatgcgcttcggcttcacg
ccgctgtacacgcgcttcgtcgacgtgtgggatgcggtcgacgtgctgcgcgacgtactg
gaaaccggcgcgtggcagtccgcccaattcaacgaacgtacgctggtgacctga

DBGET integrated database retrieval system