KEGG   Ralstonia solanacearum CMR15: CMR15_30808Help
Entry
CMR15_30808       CDS       T02725                                 

Definition
putative alkaline phosphatase signal peptide protein (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CMR15_30808
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CMR15_30808
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CMR15_30808
Enzymes [BR:rsm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CMR15_30808
Exosome [BR:rsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMR15_30808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3478508..3479911)
Genome map
AA seq 467 aa AA seqDB search
MTKQSNRIFRAGALALAAAAALPALPARAAGEAKNVIVFLGDGMGPTTVTAARIYKAGEA
GQLTMESLKRTARIKTYSNDAQTTDSAPSMSAYMTGVKMNNEVISMSADTQASDSAGKGY
VSGADTTCPAGNGTPATTLLELAKAAGKSVGAVTTTRVTHATPAATYSHICHRDGENQIA
AQGTPGNALYNAALKDGLDVLLGGGRRHFLPQGTTGSKRTDTTDLIAPFQAASYTYVSTG
TQLAAVDPAATAKLLGLFNLDHMNYELDRVNKRVDEPSLADMTEKAIRILQKNGNGYFLM
VEGGRIDHALHGVNAKRALEDTVAFDEAIKRALSLVDRGNTLIVVTADHDHTMTINGYAH
RGNPILGLSTDIKTRQPQLAADGLPYTTLVFGNGGNTRKATRDNLAAVDTTADDYLQDVG
VQLGNPGSETHGGGDVMLFSSGPGSAPLKGTLDNTRVFGAVRSAMGL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcaatcgaaccgcatcttccgcgccggcgcgctcgcgctggcggccgccgcc
gcgttgcccgcgctcccggcccgcgcggccggcgaggccaagaacgtgatcgtcttcctg
ggcgacggcatgggcccgaccaccgtcaccgccgcgcgcatctacaaggcgggcgaggcc
ggccagctgaccatggagtcgctcaagcgcaccgcgcgcatcaagacctactccaacgac
gcgcagaccaccgatagcgctccgtcgatgtcggcctacatgaccggcgtgaagatgaac
aacgaggtcatctcgatgtcggccgacacccaggccagcgacagcgccggcaagggctat
gtcagcggtgccgataccacctgccccgccggcaacggcaccccggcgaccacgctgctg
gagctggcgaaggccgccggcaagtcggtcggcgcggtgaccaccacgcgcgtcacgcat
gccacgccggccgccacgtattcgcacatctgccaccgcgacggcgagaaccagatcgcc
gcgcagggcacgccgggcaacgcgctgtacaacgccgcgctgaaggacggcctggacgtg
ctgctgggcggcggccgccgccacttcctgccgcagggcacgaccggcagcaagcgcacc
gacaccaccgacctgatcgccccgttccaggccgccagctacacctacgtgtcgaccggc
acgcagctggcggcggtcgacccggccgccaccgccaagctgctcggcctgttcaacctc
gaccacatgaactacgagctggaccgcgtgaacaagcgcgtggacgagcccagcctggcc
gacatgacggagaaggccatccgcatcctgcagaagaacggcaacggctacttcctgatg
gtcgagggcggccgcatcgaccacgcgctgcatggcgtcaacgccaagcgcgcgctggaa
gacaccgtcgccttcgacgaggccatcaagcgcgcgctgtcgctggtcgaccgcggcaac
acgctgatcgtcgtcacggccgaccacgaccacaccatgacgatcaacggttacgcccat
cgcggcaacccgatcctcgggctgtcgaccgacatcaagacccgccagccgcaactggcc
gccgacggcctgccctacaccaccctggtgttcggcaacggcggcaacacgcgcaaggcg
acgcgcgacaacctcgcggcggtcgacaccacggcggacgattacttgcaggatgtcggc
gtgcagctcggcaaccccggctcggaaacgcacggcggcggcgacgtgatgctgttctcc
tccggccccggcagcgcgccgctgaaaggcacgctggacaacacgcgggtgtttggcgcg
gtcaggtcggccatgggcctctga

DBGET integrated database retrieval system