KEGG   Ralstonia solanacearum CMR15: CMR15_mp10121Help
Entry
CMR15_mp10121     CDS       T02725                                 

Gene name
pme
Definition
Pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CMR15_mp10121 (pme)
   00500 Starch and sucrose metabolism
    CMR15_mp10121 (pme)
Enzymes [BR:rsm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CMR15_mp10121 (pme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:complement(124563..125771)
Genome map
AA seq 402 aa AA seqDB search
MTGKITMQSKTLSLKAAALLGGCTVFAATALAVTSTATRPQLSRADARTYTIANYLASFG
TIGSLTTDNWDPTGGVGAVSGFRANYAVAADGTAQYKTVQAAIDAAVNAGGVARRYISMK
AGTYNELVCVPESAPPITLYGLDANAGNTEIVYNNANPTPASGAQTNPCMGTSSNATVGT
LRSATAMVRASDFHARNLTFKNSYVEGTYADNNQSAVALAVRGDKAILENVSVIGNQDTL
FVGATNTSTVIRAYFKNSFIQGDTDFIFGAGTAVFDGCTIQYTAARLGAKGGSQIFAPST
APDNPYGFLAIHSTFNATGNPQNNRLRLGRAWDQSVSSLSAYINGSSPNGQVVIRDSSLD
ATIRVTDPWGSSTAGRPYCSANCAYSANRFFEYNNTGAGSGN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggaaaaataacgatgcaatcgaaaaccctatccttgaaagccgccgcattgctg
ggaggctgcaccgtatttgccgcaacggcgctcgccgtgacaagcaccgccacccgcccc
cagctcagccgtgctgacgcacgcacctacaccatcgcgaactacctggcgagcttcgga
acgatcggctcgctgaccacggacaactgggaccccaccggcggcgtcggcgcggtgagc
ggtttccgggccaactacgcggtcgcggcggacggcacggcgcagtacaagaccgtgcag
gccgcgatcgacgcggcagtcaacgccggcggcgtggcgcgcaggtacatcagcatgaag
gccggcacttacaacgagctggtctgcgtgcccgagtcggcgccgccgatcacgctgtat
ggcctcgacgcgaacgccggcaacacggagatcgtctacaacaacgcgaacccgacgccc
gcctcgggcgcccagaccaacccctgcatgggcaccagcagcaatgccacggtcggcacg
ctgcgcagcgccaccgccatggtgcgggcatcggacttccacgcccgcaacctgaccttc
aagaacagctacgtggaaggcacctatgccgacaacaaccagtccgcggtcgcgcttgcc
gtgcgcggcgacaaggccatcctcgaaaacgtctcggtcatcggcaaccaggacacgctg
ttcgtcggcgccacgaacaccagcacggtgatccgcgcctacttcaagaacagcttcatc
cagggcgatacggacttcatcttcggtgccggcaccgccgtcttcgatggctgcacgatc
cagtacaccgcggcacgcctcggcgccaaaggcggcagccaaatcttcgcgccgagcacg
gccccggacaatccgtacgggttcctcgccattcacagcacgttcaacgccaccggcaat
ccgcagaacaaccgtctacgcctgggacgcgcgtgggatcagagcgtgagcagcctctcg
gcctacatcaacggcagctcgcccaatgggcaggtggtgatccgcgattcgtcgctggat
gcgacgatccgggtgaccgatccgtggggctcatcgacggcggggcggccctactgttcg
gccaactgcgcgtattcggcgaatcggttctttgagtacaacaacacgggggcgggtagc
ggcaactga

DBGET integrated database retrieval system