KEGG   Ralstonia solanacearum CMR15: CMR15_mp10129Help
Entry
CMR15_mp10129     CDS       T02725                                 

Gene name
egl
Definition
Endoglucanase precursor (Endo-1,4-beta-glucanase) (Cellulase) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rsm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:137473..138708
Genome map
AA seq 411 aa AA seqDB search
MLAGCGGGDGDTSLSTASVSDTDTTTLKPAATASTSFVWLTVAQDSAAFTVSGTRTVRYG
AGSAWVQKSVSGTGQCTSAFFGKDPAAGVAKVCQLLQGTGTLLWRGVSLAGAEFGEGSLP
GTYGTNYIYPTASSATYYKNKGMNLVRLPFRWERLQPTLNQALDANELARLTGFVNAVTA
AGQTVLLDPHNYARYYGNVIGSSGVPNSAYADFWRRVATQFKGNARVIFGLMNEPNSMPT
EQWLAGANAALAAIRSANASNVVFVPGNAWTGAHSWNQNWYGTPNGTVMKGINDPGRNLV
FEVHQYLDGDSSGQSASCVSATIGAERLQDFTNWLRSNGYRGFLGEFGAASNDTCNQAVG
NMLTFVKNNADVWTGWAWWAGGPWWGGYMYSIEPSNGVDKPQMSVLAPYLK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgccggctgcggcggtggtgacggcgataccagcctgagcaccgcaagcgtgtcc
gataccgacaccacgaccctgaagcccgccgccaccgcgtcgacctcgttcgtgtggctc
accgtcgcccaggacagtgccgcgttcacggtgagcggcacgcgcacggtgcgctacggt
gccggcagcgcgtgggtgcagaagagcgtgtccggcaccggccagtgcaccagcgccttc
ttcggcaaggacccggcggccggcgtggccaaggtgtgccagctgctgcagggcacgggc
accctgctgtggcgcggcgtcagcctggccggcgccgagttcggggagggcagcctgccg
ggcacctacgggaccaactacatctatccgaccgccagcagcgcgacctactacaagaac
aagggcatgaacctggtgcgcctgccgttccgctgggagcggctgcagcccacgctcaac
caggcgctcgacgcgaacgagctggcgcgcctgaccgggttcgtcaacgccgtgacggcg
gccggccagacggtgctgctcgatccgcacaactatgcgcgctactacggcaacgtgatc
ggctcgagcggggtgcccaacagcgcgtacgccgatttctggcggcgcgtggccacccag
ttcaagggcaatgcccgcgtcatcttcgggctgatgaacgagcccaattcgatgccgacc
gagcagtggctggccggcgccaacgccgcgctggccgcgatccgctcggccaatgcgagc
aacgtggtgttcgtgcccggcaacgcctggacgggcgcgcacagctggaaccagaactgg
tacggcacgccgaacggcaccgtcatgaagggcatcaatgacccgggccgcaacctcgtc
ttcgaggtgcaccagtacctggacggcgactcgtccggccagtcggccagctgcgtgagc
gccaccatcggcgccgagcggctgcaggacttcaccaactggctgcgcagcaacggctat
cgcggcttcctgggcgagttcggcgcggcctccaacgacacctgcaaccaggccgtcggc
aacatgctcaccttcgtgaagaacaacgccgatgtctggaccggctgggcgtggtgggcg
ggcggtccgtggtggggcggctacatgtactcgatcgagccgtcgaacggcgtggacaag
ccgcagatgtcggtgctggcgccgtacctgaagtaa

DBGET integrated database retrieval system