KEGG   Ralstonia solanacearum CMR15: CMR15_mp10209Help
Entry
CMR15_mp10209     CDS       T02725                                 

Definition
putative 4-alpha-glucanotransferase (Amylomaltase)(malQ) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CMR15_mp10209
Enzymes [BR:rsm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CMR15_mp10209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:complement(239355..241679)
Genome map
AA seq 774 aa AA seqDB search
MSQRPAPPSSPPAASALHRLALDAGLLVDWEDAAGRPMRVSDDVLRAVLRSLGLPADSTA
DEADSRGRLLAEATEHALPPLVTGVAGRAVLLDTAPPWAATLGGRPYQIGFEHGGGTEGT
VHASIGQDRAALRLAPVQTPGYHRLRIDTGSRTAIETTLAIAPARCYAVSDALEARGRPP
DARLWGGSAQLYGLRHDGERAALSAGLGDYTAAGLLARSLARHGADALALSPVHAMFSAD
THRYAPYSPSSRLFLNAWMIDPAALLGAEAARQAVSDAGLADDYARLEANALIDWPASAA
ARLTVLRALHRRLRMQADAGDSAAHRRHEDMLAHCAGQGGSLVDHAHFETLDAHLRHAHP
PLHHWQHWPAPYRSPSYLAVRAFARDHPDAVDFHRFLQWAAARQLAAAQRAAEDAGMAIG
LIADLAVGTDGGGSHAWSRQQDLLIGLTVGAPPDVFNAQGQSWGLTTFSPRAMRTQGFAA
FLEMLRAVMAVPGGVRIDHVLGLMRLWVIPDGARALDGVYLRYPLRDLLRLIALESWRNR
CIVIGEDLGTVPAGLREQLADAGLLGMRILWFERDYARPEAPFRPPQAWSPASVAMTSTH
DLPTVEGWWTGHDLHWQARLGLLPIGMNETEARTRRMADRRALVGAFAQHHRTTVPTAGD
DAAQRIAALQTALAQARTATPAQVDTLLAATAGDFATAALAYAAAAPVPLAIAPMEDLLG
LLEQPNLPSTIETHPNWRRRLSAPAAGLLAAPAIRARLAALARSRANADPDSPP
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacgccccgcgcccccctcgtccccgcctgccgccagcgcgctgcaccggctg
gcgctggacgccggcctgctggtcgactgggaagacgccgccggccgcccgatgcgcgtg
agcgacgacgtgctgcgcgccgtgctgcgcagcctgggcctgcccgccgacagcaccgcc
gacgaggccgacagccggggcaggctgctggccgaagcgaccgagcacgcgctgccaccg
ctggtcaccggggtggccggacgcgccgtcctgctggacaccgcgccaccgtgggcggcc
acgctcggcggacggccctaccagatcggcttcgagcacggcggcggcaccgaaggcacg
gtgcacgcgagcatcgggcaggatcgggccgcgctgcggctggcgccggtacagacgccg
ggctaccaccggctgcgcatcgacaccggcagccgcaccgccatcgagaccacgctggcc
atcgcgccggcgcgctgctacgcggtgtccgatgcgctggaggcgcgcgggcgcccgccc
gatgcgcggctgtggggcggctccgcgcagctctacggcctgcgccacgacggcgagcgg
gccgcgctctcagcagggctgggcgactacaccgcggccggcctgctggcgcgcagcctg
gcgcggcacggcgccgacgcgctggcactgagcccggtgcacgccatgttcagtgcggac
acgcatcgctacgcgccctactcgccatcgagccggctgttcctcaatgcgtggatgatc
gacccggccgcgctgctcggcgccgaggccgcgcggcaggcggtgagcgacgccggcctg
gcggacgactacgcccggctggaggcgaatgccctgatcgactggcccgccagcgccgcc
gcgcggctgacggtgctgcgcgcgctgcatcgccgcctgcggatgcaggccgacgccgga
gacagcgccgcgcaccgccggcacgaagacatgctcgcccactgcgccggccaaggcggc
agcctggtcgaccacgcgcacttcgaaacgctggacgcccacctgcgccacgcgcatccg
ccgctgcaccactggcagcactggcccgcgccctaccggtcgccgtcgtacctggcggtg
cgcgccttcgcccgcgaccaccccgacgcggtggatttccaccgtttcctgcaatgggcg
gcggcgcgccagctggccgccgcgcagcgcgccgccgaagacgccggcatggccatcggc
ctgatcgccgacctcgcggtcggcaccgacggcgggggcagccatgcgtggagccggcag
caggacctgctgatcggcctgacggtgggcgcgccgccggacgtgttcaacgcgcaaggg
caaagctgggggctcaccaccttcagcccgcgcgcgatgcgcacgcagggcttcgccgcc
ttcctcgagatgctgcgggccgtgatggccgtgcccggcggcgtgcgcatcgaccatgtg
ctggggctgatgcggctgtgggtgattcccgacggcgcgcgggcgctggatggcgtgtac
ctgcggtatccgctgcgcgacctgctgcggctgatcgcgctggagtcgtggcgcaatcgc
tgcatcgtcatcggcgaggatctcggcaccgtgccggcgggcctgcgcgaacagctggcc
gacgcgggcctgctcggcatgcgcatcctgtggttcgagcgtgactatgcgcggcccgag
gcgccgttccgcccgccgcaagcgtggtcgcccgcctcggtggccatgaccagcacgcac
gacctgcccaccgtagaaggctggtggaccggccacgacctgcactggcaggcccggctc
gggctgctgccgatcggcatgaacgaaaccgaagcgcgcacgcgccgcatggcggaccgg
cgcgcactggtcggcgccttcgcgcaacaccatcgcaccaccgtgcccacggccggcgac
gacgcggcacagcgcatcgccgccctgcagaccgcgctcgcgcaggcacgcaccgccact
ccggcgcaagtggacaccctgctggccgccactgcgggcgatttcgccaccgccgccctc
gcctacgcggcggccgcgccggtgccgctggcgatcgccccgatggaagacctgctcggc
ctgctggagcagcccaacctgcccagcaccatcgagacgcatcccaactggcgccgccgc
ctgtccgcgcccgcggccgggctgctggcggcccccgccatccgggcgcggctggcggcc
ctggcgcgctcgcgcgcaaacgccgacccggattccccgccatga

DBGET integrated database retrieval system