KEGG   Ralstonia solanacearum CMR15: CMR15_mp10213Help
Entry
CMR15_mp10213     CDS       T02725                                 

Gene name
TreS
Definition
Trehalose synthase, Maltose alpha-D-glucosyltransferase; Alpha amylase, catalytic subdomain (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rsm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:complement(248733..252227)
Genome map
AA seq 1164 aa AA seqDB search
MTRNPTVLLVDDALWYKDAVIYQLHVKSFCDSDNDGVGDFPGLISKLDYIAELGVDAVWL
LPFYPSPRRDDGYDIAEYRGVHPDYGTMADARRFIAEAHARGLRVITELVINHTSDQHPW
FQRARRAKAGSALRDFYVWSDHDKKYAGTRIIFIDTEPSNWTWDPVANAYYWHRFYSHQP
DLNFDNPRVLKAVLGVMKFWLNLGVDGLRLDAVPYLVEREGTANENLPETHAVLRKIRAA
MDAEFKNRLLLAEANQWPEDTQEYFGNGDECHMAFHFPLMPRMYMAIAREDRFPITDIMR
QTPEVPPTCQWAIFLRNHDELTLEMVTDAERDYLWEVYASDRRARLNLGIRRRLAPLLER
DRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADP
EQLVLPAIMGSLYGYESVNVEAQTRDAHSLLNWTRRLLATRKRHRVFGRGSIQFLQPANR
KVLAYIRALEGQSHDHPPILCVANLSRASQAVELDLSGYAQRVPVELIGGTAFPPIGQLP
YLLTLPAYAFYWLELRENEPGPSWAQPAAEQLPEFTTLVLRAGLDALADTRQREAHRQLI
EREILPTYLPKRRWFAAKDSVLRGAHFAWGTELPVDAASTNRPLAGATRPEVFINEIAVT
LGDADGTERTERYLLPLSIAWESATLPALPIQLALARVRRGRHVGYLTDAFATETFARVL
LANLMRGVTLEASDGRVHFEPEPHLAELAEPPVAAETGAVRPAPLPLAPDAPVQWLAAEQ
SNSSLVIGESVIVKLFRRVAVGVHPEVEMTRHLTRIGYANTAALIGEIAHEGADGERSTL
AVLQSFVPNQGDAWTWALDYLRRTIDELAVLTEAVSAGDGDAAPTAVSEARTDTDEALAG
YLAFIGAIGTRLGELHVALAGPSDDPAFGTRAADADDAAFWTARVGEELARALDHLAAWQ
AANGPRAEVGWLLSQHDALLAAARERAQGGLGAMLARIHGDFHLGQVLVAQGDAYLIDFE
GEPSRPVDERRRKTSPLRDVAGLVRSLDYVVGAMRQGPEHVAGPAQERRDQLLERFRNAS
TERFLEAYATAILAPGSDDGACMLDLDLLDLFLLEKAAYEVNYEAANRPTWLPIPLAGLA
QVARRLLPADVAPPVVRDPPGGTP
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaacccgaccgtgctgctggtggacgacgcgctctggtacaaggacgcggtc
atctatcagctgcacgtcaaatcgttctgcgactcggacaacgacggcgtgggggacttc
ccgggcctgatctccaagctcgactacatcgccgagctgggcgtggacgcggtctggctg
ctgccgttctacccctcgccgcgccgcgacgacggctacgacatcgccgaataccgcggc
gtgcaccccgactacggcaccatggccgacgcgcgccgcttcattgccgaggcgcacgcg
cgcgggctgcgcgtcattaccgagctggtcatcaaccacacctcggaccagcacccgtgg
ttccagcgtgcgcggcgcgccaaggcgggctccgcgctgcgcgacttctacgtgtggtcg
gaccacgacaagaaatacgccggcacgcgcatcatcttcatcgacaccgagccctccaac
tggacctgggacccggtggccaacgcctactactggcaccgcttctattcgcaccagccc
gacctgaacttcgacaacccgcgcgtgctcaaggccgtgctgggcgtgatgaagttctgg
ctcaacctgggcgtggacggcctgcgcctggatgccgtgccctacctggtggagcgcgag
ggcaccgccaacgagaacctgcccgagacgcacgccgtgctgcgcaagatccgcgcggcg
atggacgcggagttcaagaaccgcctgctgctggccgaagccaaccagtggcccgaagac
acgcaggaatacttcggcaacggcgacgagtgccacatggccttccactttccgctgatg
ccgcgcatgtacatggcgatcgcgcgggaggaccgctttccgatcaccgacatcatgcgg
cagacgcccgaggtgccgcccacctgccagtgggccatcttcctgcgcaaccacgacgag
ctgacgctggagatggtgaccgacgcggagcgcgactacctgtgggaggtctacgccagc
gaccgccgcgcgcggctgaacctcggcatccgccggcgcctggcgccgctgctggagcgc
gaccgccgccgcgtggagctgatgaacagcctgctgttctcgatgcccggcacgccggtg
atgtactacggcgacgagatcggcatgggcgacaacatccacctgggcgaccgcgacggc
gtgcgcacgccgatgcagtggtcgcccgaccgcaacggcggcttctcgcgcgccgatccg
gagcagctggtgctgccggccatcatgggctcgctgtacggctatgaatcggtcaacgtg
gaagcgcagacgcgcgacgcgcattcgctgctgaactggacgcgccggctgctggccacg
cgcaagcgccaccgcgtgttcgggcgcggcagcatccagttcctgcagccggccaaccgc
aaggtgctggcctatatccgcgcgctggagggccagagccacgaccatcccccgatcctg
tgcgtggcgaacctgtcgcgcgcctcgcaggcggtggagctggacctgtccggctacgcg
cagcgcgtaccggtggagctgatcggcggcacggcgtttccgcccatcggccagttgccc
tatctgctgacgctgccggcctatgcgttctactggctggagctgcgcgagaacgagccc
ggcccctcgtgggcgcagccggccgcggagcagttgcccgagttcaccacgctggtgctg
cgcgcggggctcgatgcgctggccgacacgcgccagcgcgaggcgcaccggcaactgatc
gagcgcgagatcctgccgacctatctgcccaagcgccgctggttcgcggccaaggacagc
gtgctgcgcggcgcgcacttcgcctggggcaccgagttgccggtggatgcggcctccacc
aaccggccgctggcgggggcgacccggcccgaggtgttcatcaacgagatcgccgtcacg
ctgggcgatgcggacggcaccgagcgcaccgagcgctacctgctgccgctgtcgatcgcg
tgggagagcgccacgctgcccgcgctgccgatccagctggcgctggcgcgcgtgcggcgc
ggccgccatgtcggctacctgaccgatgccttcgccaccgagaccttcgcccgtgtgctg
ctggccaacctgatgcgcggcgtcacgctggaggccagcgacggccgcgtgcatttcgag
cccgagccgcacctggccgaactggccgagccgccggtggccgccgaaaccggcgcggtg
cgcccggcgccgctgccgctggcgcccgacgcgccggtgcagtggctggcggcggagcag
tccaacagctcgctggtgatcggcgaatcggtcatcgtcaagctgttccgccgggtggcg
gtgggtgtgcatccggaagtggagatgacgcgccacctcacgcgcatcggctatgccaac
acggccgcgctgatcggcgagatcgcgcacgagggcgcagacggcgagcgcagcacgctg
gccgtgctccaaagcttcgtgcccaaccagggcgatgcgtggacctgggcgctcgattac
ctgcgccgcaccatcgatgagctggcggtgctgaccgaggccgtctcggccggcgacggc
gacgcggcgcccaccgccgtctcggaagcgcgcaccgataccgatgaagcgctggcgggc
tacctggccttcatcggcgcgatcggcacgcggttgggcgaactgcacgtcgcgctggcc
ggaccgtcggacgatccggccttcggcacccgcgccgccgacgccgacgacgcggccttc
tggaccgcgcgcgtgggcgaggagctggcccgcgcgctcgaccacctcgcggcatggcag
gcggccaacggaccgcgcgccgaggtcggctggctgctgtcgcagcacgatgccctgctg
gcagccgcccgcgaacgcgcgcagggcggcctgggcgcgatgctggcgcgcatccacggc
gacttccacctcggccaggtgctggtggcgcagggcgatgcctacctgatcgacttcgag
ggcgagccgtcgcggccggtggacgagcgccggcgcaagaccagcccgctgcgcgacgtg
gccgggctggtgcgctcgctcgactacgtggtgggcgccatgcggcaggggcccgagcat
gtggccgggccggcgcaggagcggcgcgaccagttgctcgaacgcttccgcaatgcgtcc
accgagcgcttcctggaggcgtacgcgaccgccatcctggcccccggttccgatgacggc
gcctgcatgctcgatctggacctgctcgacctgttcctgctggagaaggcggcctacgag
gtcaactacgaagcggccaaccggccgacatggctgccgatcccgctggcgggcctggcg
caggtggcgcgccggctgctgccggcggacgtggcgccacccgtggtgcgggacccgccc
ggaggcacgccgtga

DBGET integrated database retrieval system