KEGG   Ralstonia solanacearum CMR15: CMR15_mp10758Help
Entry
CMR15_mp10758     CDS       T02725                                 

Definition
putative Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CMR15_mp10758
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CMR15_mp10758
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CMR15_mp10758
Lipid biosynthesis proteins [BR:rsm01004]
 Desaturase
  First
   CMR15_mp10758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:885290..886195
Genome map
AA seq 301 aa AA seqDB search
MIEESVMLRQHNLRLRKYDYVLGRLFVALPIGGLVVAVLLWLADWQVGRFELAMCLAMYL
FTMMGIEVGFHRCFAHRAFKASTGLQWVLAVAGSMGGHGPLIWWVTTHRRHHRFVDTEHD
PHTPNKDLRGPWRNFKSFLYGYVGWTMDTDVKLQEGWQRYGVDLYKNSILFKVHARFALI
ALLGLLLPTVAGALFHRTAEGALLGLLWGGLVPICLTQHLFWMINAFGHRIGAKPFNGRI
VGDSRNCWWLALPTFGQGWHNNHHADPGCATTRKTWWQLDPGAWLIRLFERLGWASAVKW
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagagtccgtcatgctgcggcagcacaacctgaggctgcgcaagtacgactac
gtcctggggcgcctgttcgtggccttgccgatcggcgggctggtggtcgccgtgctgctg
tggcttgcggattggcaggtgggccggttcgagctggcgatgtgcctggcgatgtatctg
ttcacgatgatggggatcgaggttgggttccatcgctgcttcgcgcaccgcgccttcaag
gccagcacgggtttgcaatgggtgctcgcggtggccggctccatgggtgggcatggcccc
ctgatctggtgggtcaccactcatcggcggcatcaccggtttgtcgataccgaacacgat
ccgcatacgcccaacaaggatctgcgcggcccgtggcgcaacttcaagtcgttcctctac
ggctacgtcggctggaccatggatacggacgtgaagctgcaggaaggctggcagcgctac
ggcgtcgatctctacaagaacagcatcctgttcaaggtgcacgcgcgctttgccctgatc
gcgctgctggggctgctgctgcccaccgtggccggggcgctgttccatcgcacggccgag
ggcgcgctgctggggctgctgtggggcggcctggtgccgatctgcctgacgcagcatctg
ttctggatgatcaatgcgttcgggcaccggatcggcgccaagcccttcaacggccggatc
gtcggcgacagccgcaattgctggtggctggcgctgccgaccttcggccagggctggcac
aacaaccaccacgccgatcccggatgcgccaccacgcgcaagacctggtggcagctggac
cccggcgcctggctgatccgcctgttcgagcggctgggctgggccagcgccgtcaagtgg
aaatag

DBGET integrated database retrieval system