KEGG   Ralstonia solanacearum CMR15: CMR15_mp10758Help
Entry
CMR15_mp10758     CDS       T02725                                 

Definition
putative Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rsm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:885290..886195
Genome map
AA seq 301 aa AA seqDB search
MIEESVMLRQHNLRLRKYDYVLGRLFVALPIGGLVVAVLLWLADWQVGRFELAMCLAMYL
FTMMGIEVGFHRCFAHRAFKASTGLQWVLAVAGSMGGHGPLIWWVTTHRRHHRFVDTEHD
PHTPNKDLRGPWRNFKSFLYGYVGWTMDTDVKLQEGWQRYGVDLYKNSILFKVHARFALI
ALLGLLLPTVAGALFHRTAEGALLGLLWGGLVPICLTQHLFWMINAFGHRIGAKPFNGRI
VGDSRNCWWLALPTFGQGWHNNHHADPGCATTRKTWWQLDPGAWLIRLFERLGWASAVKW
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagagtccgtcatgctgcggcagcacaacctgaggctgcgcaagtacgactac
gtcctggggcgcctgttcgtggccttgccgatcggcgggctggtggtcgccgtgctgctg
tggcttgcggattggcaggtgggccggttcgagctggcgatgtgcctggcgatgtatctg
ttcacgatgatggggatcgaggttgggttccatcgctgcttcgcgcaccgcgccttcaag
gccagcacgggtttgcaatgggtgctcgcggtggccggctccatgggtgggcatggcccc
ctgatctggtgggtcaccactcatcggcggcatcaccggtttgtcgataccgaacacgat
ccgcatacgcccaacaaggatctgcgcggcccgtggcgcaacttcaagtcgttcctctac
ggctacgtcggctggaccatggatacggacgtgaagctgcaggaaggctggcagcgctac
ggcgtcgatctctacaagaacagcatcctgttcaaggtgcacgcgcgctttgccctgatc
gcgctgctggggctgctgctgcccaccgtggccggggcgctgttccatcgcacggccgag
ggcgcgctgctggggctgctgtggggcggcctggtgccgatctgcctgacgcagcatctg
ttctggatgatcaatgcgttcgggcaccggatcggcgccaagcccttcaacggccggatc
gtcggcgacagccgcaattgctggtggctggcgctgccgaccttcggccagggctggcac
aacaaccaccacgccgatcccggatgcgccaccacgcgcaagacctggtggcagctggac
cccggcgcctggctgatccgcctgttcgagcggctgggctgggccagcgccgtcaagtgg
aaatag

DBGET integrated database retrieval system