KEGG   Ralstonia solanacearum CMR15: CMR15_mp10878Help
Entry
CMR15_mp10878     CDS       T02725                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase, NAD-binding (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CMR15_mp10878 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMR15_mp10878 (mhpF)
   00650 Butanoate metabolism
    CMR15_mp10878 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CMR15_mp10878 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CMR15_mp10878 (mhpF)
   00622 Xylene degradation
    CMR15_mp10878 (mhpF)
   00621 Dioxin degradation
    CMR15_mp10878 (mhpF)
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CMR15_mp10878 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:1026632..1027552
Genome map
AA seq 306 aa AA seqDB search
MTRKLKVAIIGSGNIGTDLMIKVLRHGGPIEMGAMVGIDPGSDGLARAARLGVPTTAEGL
EGLLRLPGFKDIGLVFDATSAGAHHRHAARLAELGVPMIDLTPAAIGPYVVPVVNGDAHR
GAPNINMVTCGGQATIPIVAAVSQVTRVHYAEIVASIASRSAGPGTRANIDEFTETTSRA
IEAVGGAERGKAIIILNPAEPPLMMRDTVFTFSAPANEREVETSIEAMVAKVQAYVPGYR
LKQRVQFEPAEVALPGAGRVHGLKTTVLLEVRGAAHYLPEYAGNLDIMTSAALACAQAQA
AARIAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaaagcttaaggttgcgatcatcgggtcgggcaacatcggcaccgatctcatg
atcaaggtgctgcgccacggcgggcccatcgaaatgggcgcgatggtggggatcgatccc
ggctccgacgggctggcgcgcgccgcgcgcctgggcgtgcccaccacggccgaaggcctg
gagggcctgctgcgcctgccgggcttcaaggacatcggcctggtcttcgatgccacatcg
gcgggagcgcatcaccggcacgcggcccggctggccgagctcggcgtaccgatgatcgat
ctcacgcccgcagccatcggcccgtatgtggtgccggtggtcaatggcgacgcgcaccgg
ggcgccccgaacatcaacatggtgacctgcggcgggcaggcgacgatccccatcgtggcg
gccgtctcgcaggtgacccgcgtgcactacgccgagatcgtcgcgtcgatcgccagccgg
tcggcaggccccggcacgcgcgccaacatcgacgagttcaccgagaccacgtcgcgggcg
atcgaggcggtcgggggcgccgagcgcggcaaggccatcatcatcctcaatccggccgag
ccgccgctgatgatgcgcgacaccgtgttcaccttcagcgcccccgcgaacgagcgcgag
gtggagaccagcatcgaggcgatggtcgccaaggtgcaggcctacgtgcccggctaccgg
ctcaagcagcgggtgcagttcgagcctgccgaggtggcgctgcccggcgccggccgcgtg
cacgggctgaagaccaccgtcctgctggaggttcgcggggcggcacactacctgccggaa
tacgccggcaacctcgacatcatgacgtcggcggccctggcttgcgcgcaagcgcaggcg
gcggcccgcatcgccgcgtga

DBGET integrated database retrieval system