KEGG   Ralstonia solanacearum CMR15: CMR15_mp30228Help
Entry
CMR15_mp30228     CDS       T02725                                 

Gene name
katB
Definition
Catalase precursor (Paraquat-inducible catalase isozyme B) (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
rsm  Ralstonia solanacearum CMR15
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CMR15_mp30228 (katB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CMR15_mp30228 (katB)
Enzymes [BR:rsm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CMR15_mp30228 (katB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
CMR15_mp:complement(1856154..1857683)
Genome map
AA seq 509 aa AA seqDB search
MSFPSRSLRVSLLALAALTAFHAGAVTLTRDNGAPVGDNQNSQTAGPNGPVLLQDVQLIQ
KLQRFDRERIPERVVHARGTGAHGVFVASKDISDLTRAKVFTPGEETPVFVRFSSVIHSG
HSPETLRDPRGFATKFYTREGNWDLVGNNLPVFFIRDAMKFPDMVHSLKPSPDSNLQDPN
RYFDFFSHEPESTHMLTRVYTDYGTPASYREMDGNSVHAYKFVNAKGEVHYVKFHWKSLQ
GQKGLSAKEVEAIQGKDFNHLTRDLIANIDKGNYPKWDLYIQILAPEQLAKFDFDPLDAT
KVWPDVPEVKVGTMTLNKNPENVFQETEQAALAPSNLVPGIEPSEDRLLQGRIFSYADTQ
LYRVGTNGLQLPVNRPRTSAANYNQDGDLNAGARKGSVNYQPSAHADLSDAATVKYSQLP
VSGTTQQQRIARTQNFKQAGDYYRSLTAKEQANLVSNLAGDLGQVKDDGVKYTMLSYFQK
ADAGYGRALAQAVKADPARVESLAAKLQD
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcccctcccgttccctgcgtgtgtccctactggcgctggccgcactgaccgcc
ttccacgcgggcgcggtcacgctgacccgcgacaacggcgcgccggtcggcgacaaccag
aattcgcagacggccggccccaacggcccggtcctgctgcaggacgtgcagctcatccag
aagctgcagcgctttgatcgcgagcgcattcccgagcgcgtcgtccacgcgcgcggcacc
ggcgcgcacggcgtgttcgtcgcctccaaggacatctccgacctgacccgcgccaaggtc
ttcacgcccggcgaagagacgccggtgttcgtgcgcttctccagcgtgatccacagcggc
cattcgccggagacgctgcgcgatccgcgcggcttcgccaccaagttctacacccgcgaa
ggcaactgggacctggtcggcaacaacctgccggtgttcttcatccgtgacgcgatgaag
ttcccggacatggtccactcgctcaagccgtcgcccgacagcaacctgcaggacccgaac
cgctacttcgacttcttctcgcacgagcccgagtccacgcacatgctgacgcgggtgtac
accgactacggcacgcccgctagctaccgcgagatggacggcaacagcgtgcacgcctac
aagttcgtcaacgcgaagggcgaggtgcactacgtcaagttccactggaagagcctgcag
ggccagaagggtctgagcgccaaggaagtcgaggccatccagggcaaggacttcaaccac
ttgacgcgtgacctgatcgccaacatcgacaagggcaactatccgaagtgggatctgtac
atccagatcctggcgccggagcagctcgccaagttcgacttcgatccgctggatgccacc
aaggtctggccggacgtgccggaagtgaaggtcggcacgatgacgctgaacaagaacccg
gagaacgtcttccaggaaaccgaacaggccgcgctggcgccgtccaacctggtgccgggc
atcgagccctcggaagaccgcctgctgcagggccgcatcttctcgtacgccgacacgcag
ctgtatcgcgtgggtaccaacggtctgcaactgccggtgaaccgcccgcgcacgtctgcc
gccaactacaaccaggatggcgatctgaatgccggcgcgcgcaagggcagcgtcaactac
cagcccagcgcccacgccgatctgagcgatgcggcaacggtcaagtacagccagctgccg
gtctcgggcaccacccagcagcagcgcatcgctcgcacgcagaacttcaagcaggccggc
gactactaccgttcgctgacggccaaggagcaggccaacctggtcagcaacctggccggc
gacctggggcaggtgaaggatgacggcgtgaagtacaccatgctgtcgtacttccagaag
gcggatgccggctacggccgcgcgctggcccaggccgtcaaggccgatccggcccgcgtg
gaatcgctggccgcgaagttgcaggactga

DBGET integrated database retrieval system