KEGG   Ralstonia solanacearum Po82: RSPO_c00444Help
Entry
RSPO_c00444       CDS       T02005                                 

Gene name
glpK
Definition
glycerol kinase (atp:glycerol 3-phosphotransferase)(glycerokinase) (gk) protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rsn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(461015..462511)
Genome map
AA seq 498 aa AA seqDB search
MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEHDPLDIWNSQLATCRA
ALEQAKLTAADMAALGITNQRETTVVWERATGRPIFNAIVWQDRRTEAICERLRAEGLED
EVRKRTGLVIDPYFSGTKLRWILDHVDGARERAARGELAFGTIDSWLVWQLTRGRLHVTD
VSNASRTLLWNIHTGQWDAELMRALDIHPSLLPEVHPSAHRFGQTDADWLGAPLTIGGIA
GDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGERAVESHNGLISTAACQSGAKRSYALE
GSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDPTAQGA
IVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSAISELRVDGGASANNLLLQFQA
DLLGIPVVRPEIIETTALGAAYLAGIATGFYRGEDEVAQQWRASRTFHPVISRDEAQHRM
AQWETAVAQVRLPTTQGR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaatacctcctcgcgctcgaccagggcacctccagttcgcgtgccatcgtgttcaac
cgtgccggccagatcgtcgccagcgcccagcaggagtttccgcagcattttccgcagccc
ggctgggtcgagcacgatccgctcgacatctggaacagccagctcgccacctgccgcgcc
gcactcgagcaggcgaagctgaccgccgccgacatggccgcgctcggcatcaccaaccag
cgcgagaccaccgtggtgtgggagcgcgccaccggccgccccatcttcaacgccatcgtc
tggcaggaccgccgcaccgaggcgatctgcgaacggctgcgcgccgagggcctggaagac
gaggtgcgcaagcgcaccgggctggtgatcgatccgtatttctcgggcaccaagctgcgc
tggatcctcgaccacgtggacggggcccgcgaacgcgccgcgcgcggcgagctggccttc
ggcaccatcgacagctggctggtgtggcagctcacgcgcggccgcctgcatgtgaccgac
gtgtccaacgcctcgcgcaccctgctgtggaacatccacaccggccagtgggatgccgaa
ctgatgcgtgcgctcgacatccatccgagcctgctgccggaggtgcacccgtccgcccat
cgcttcggccagaccgatgccgactggctgggcgcgccgctcaccatcggcggcatcgcc
ggcgaccagcagtcggcactgttcggccaggcctgcttcaagccgggcatggccaagaac
acctacggcaccggctgcttcatgctgctcaacaccggtgagcgcgcggtcgaatcgcac
aatgggctgatcagcacggcggcctgccagagcggtgcgaaacgcagctacgcgctggaa
ggcagcgtgttcgtcggcggcgcggtggtgcagtggctgcgcgacggcctgcgcgcgatc
cagcgctcggccgacgtggaagggctggccgcctcggtgccggactcgggcggcgtggtg
ttcgtgccgtcgttcaccgggctgggggcgccctactgggacccgaccgcgcagggggcg
atcgtcgggctgtcgcgcggcacgaccatcggccatatcgcgcgggcggcgctggagtcg
atcgcgttccagagcaccgcgctgctgcaggcgatgacgcgcgacgcggtgtcggccatc
tcggagctgcgcgtggacggcggcgcctcggcgaacaacctgctgctgcagttccaggcc
gacctgctcggcattccggtggtgcgcccggagatcatcgagaccacggcgctgggcgcg
gcctacctggccggcatcgccaccggcttctaccggggcgaagacgaggtcgcgcagcag
tggcgcgcctcgcgcacgttccaccccgtcatcagccgcgacgaagcgcagcaccgcatg
gcgcagtgggagacggcggtggcgcaggtgcggctgccgaccacgcagggccgctga

DBGET integrated database retrieval system