KEGG   Ralstonia solanacearum Po82: RSPO_c00549Help
Entry
RSPO_c00549       CDS       T02005                                 

Gene name
hisD
Definition
histidinol dehydrogenase (hdh) protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPO_c00549 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    RSPO_c00549 (hisD)
Enzymes [BR:rsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RSPO_c00549 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570835..572163
Genome map
AA seq 442 aa AA seqDB search
MSLTIRKLDSADAGFAAQLRQVLAFEASEDEAIDRAAAQILADVKARGDAAVLETTRRFD
RIEADSVAALELSPAALQAALDGLEPKRRAALEAAAARVRAYHEKQKIECGTHSWEYAEA
DGTVLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEIIMVVPTPGGVRNELV
LAAACIAGVDRVFTIGGAQAVGALAYGTETVPAVDKIVGPGNAYVAAAKRRVFGTVGIDM
IAGPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDAGFIAQVEASIRRQLDDM
PRKEVIAASLSGRGALIRVRDMDEACEIANDIAPEHLEVSAEHPRQWAERIRHAGAIFLG
KYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSLIEVSEAGAQMLGEIASELA
YGEGLQAHARSAEYRLQRTTTE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgaccatccgcaaactggattcggccgatgccggattcgcggcgcaactgcgc
caggtgcttgccttcgaagcgagcgaagacgaagccatcgaccgcgccgccgcgcagatc
ctggccgatgtgaaggcgcgcggcgatgccgccgtgctcgagaccacgcgccgcttcgac
cgcatcgaagccgacagcgtggccgcgctggaactgtcgccggccgcgctgcaggccgcg
ctcgatgggctggagcccaagcgccgcgccgcgctggaggccgccgccgcccgcgtgcgt
gcctaccacgagaagcagaagatcgagtgcggcacgcacagttgggagtacgcggaagcc
gacggcaccgtgctcggccagaaggtcacgccgctcgaccgcgtcggcatctacgtgccg
ggtggcaaggcggcgtacccgtcgtcggtgctgatgaacgcgattccggcgcgcgtggcg
ggcgtcaaggaaatcatcatggtggtgcccacgcccggcggcgtgcgcaacgagctggtg
ctggccgcggcctgcatcgccggggtggaccgcgtgttcaccatcggcggcgcacaggcc
gtcggggcgctcgcttatggtaccgagaccgtgcctgccgtcgacaagatcgtcggcccg
ggcaacgcctatgtggcggcggccaagcggcgcgtgttcggcacggtcggcatcgacatg
attgccgggccgtccgagatcctcgtgatctgcgacggcaccaccgatccggactgggtg
gcgatggatctgttctcgcaggccgagcatgatgaacttgcgcagtcgatcctgctgtgt
ccggacgccggcttcatcgcccaggtggaggccagcatccggcgccagctcgacgacatg
ccgcgcaaggaagtgatcgccgcgtcgctgtcgggccgcggggcgctgatccgggtacgc
gacatggacgaggcgtgcgagatcgccaacgacatcgcgccggagcacctggaggtctcc
gccgagcacccgcgccagtgggccgagcgcatccgccacgcgggcgccatcttcctcggc
aagtacaccagcgagtcgctgggcgactactgcgcgggcccgaaccacgtgctgccgacc
tcgcgcacggcgcgcttctcgtctccgctgggcgtgtacgacttcatcaagcgctccagc
ctgatcgaggtgagcgaagcgggcgcgcagatgctgggcgagatcgcctccgagctggcc
tacggcgagggtttgcaggcgcatgcccgcagcgccgaataccgcctgcaacgcacgacc
accgagtga

DBGET integrated database retrieval system