KEGG   Ralstonia solanacearum Po82: RSPO_c00616Help
Entry
RSPO_c00616       CDS       T02005                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rsn  Ralstonia solanacearum Po82
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632180..632926
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAALVAAMGAGYALTAGAAEPALDKVKMSVQKALGSNVEIKGVAKSPLP
GLYEVNLGSQVVYTDATGRYVLNGDLLDTQTATNLTQERMTEINRVKWADLPLDRAVKWV
KGNGARKIAVFSDPNCPYCHKLEQMFSQVDNITVYTFLLPILSEDSSIKAKQIWCSADRA
KAWRDWMVSKSAPGGTGNCDTPLEDNLKLGRELNVNGTPAIIFTDGSRAPGLIDAAALER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcttcggcggcactggtcgccgccatgggc
gcgggttacgcgctgaccgccggtgccgccgagcccgcgctggacaaggtcaagatgtcg
gtgcagaaggcgctggggtcgaacgtggaaatcaagggcgtcgccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcagccaggtcgtctacaccgacgccaccggccgctac
gtgctcaacggcgacctgctcgacacgcagaccgccaccaacctcacgcaggagcgcatg
acggagatcaaccgcgtcaagtgggccgatctgccgctggaccgcgcggtgaagtgggtc
aagggcaacggcgcgcgcaagatcgccgtgttctccgacccgaactgcccgtactgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgttgccg
atcctgtccgaagattccagcatcaaggccaagcagatctggtgctcggccgaccgtgcc
aaggcctggcgcgactggatggtgtccaagagcgccccgggcggcaccggcaattgcgat
acgccgctggaggacaacctgaagctgggccgcgaactcaacgtcaacggcaccccggcc
atcatcttcacggacggttcgcgggcgccgggcctgatcgatgcggccgcgctggagcgc
aagttcgcgtcgctgaagaagtcgtaa

DBGET integrated database retrieval system