KEGG   Ralstonia solanacearum Po82: RSPO_c00744Help
Entry
RSPO_c00744       CDS       T02005                                 

Gene name
rnaSA
Definition
guanyl-specific ribonuclease sa3
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rsn  Ralstonia solanacearum Po82
Brite
Enzymes [BR:rsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RSPO_c00744 (rnaSA)
Transfer RNA biogenesis [BR:rsn03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RSPO_c00744 (rnaSA)
 Prokaryotic Type
    RSPO_c00744 (rnaSA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778106..778537
Genome map
AA seq 143 aa AA seqDB search
MTKRLGAWIGRSVSQAMVRGALAAMLALSAAGLPATAAARDTTGMTAVMGTIPAADLPNE
AQRALVLIEQGGPFPYAKDGTTFGNYEGRLPARKRGYYHEYTVKTRGARNRGARRIICGG
DQRAANDCYYTKDHYNSFQRIQR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcgacttggggcgtggatcggccgctccgtatctcaggcgatggtgcggggt
gcgctggcggcgatgcttgcgctgtccgccgccgggttgccagcgacggctgccgcccgg
gacaccaccggcatgacggcggtgatgggaaccattcctgcggcggacctgcccaatgag
gcgcagcgcgcgctggtgctgatcgagcagggcggtccgtttccctatgcgaaagatggc
accacgttcggcaattatgagggccgtttgccggcacgaaagcgtggctactatcacgaa
tacaccgtgaagacgcgcggtgcgcgcaatcgtggcgccaggcgcatcatctgcggcggc
gaccagcgcgcggccaacgattgctactacacgaaagatcactacaacagctttcaacgg
atacagcgatga

DBGET integrated database retrieval system