KEGG   Ralstonia solanacearum Po82: RSPO_c00996Help
Entry
RSPO_c00996       CDS       T02005                                 

Gene name
ole1
Definition
Acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rsn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1040115..1041311
Genome map
AA seq 398 aa AA seqDB search
MNLIDSFLSFLANGTLNWAWWQILIFTLAVTHMTIASVTIFLHRCQAHRALDLHPAAAHV
FRFWLWLTTGMVTKEWAAIHRKHHAKCETEDDPHSPQTRGIRKVLLEGAELYRAESKNRE
TIQKFGHGTPNDWIEQNLYSKYTWQGVGLMLILDVLMFGAVGLTVWAVQMLWIPVHAAGI
INGLGHYWGYRNFDCEDASTNVFPWGLIIGGEELHNNHHTYATSAKFSIKWYEFDVGWGY
IRALEMVGLAKVKKVAPKARFGDVKPVDQNTLEAIIANRYDVMARYAKTVKAAYRQELAR
LKADRDVEYRALKPASKWFHRDEAKLGAPQREQLSQIVSDHSALHTFVEMRRELGALWGR
SNATREQLLHQLQEWCKRAEESGIHALQEFALRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgatcgactcctttctgagtttccttgccaacggcaccctgaactgggcttgg
tggcagatcctgattttcacgctggcggtgacgcacatgaccatcgccagcgtcacgatt
ttcctgcatcgctgccaggcgcaccgcgcgctggatctgcatccggccgccgcgcacgtt
ttccgcttctggctctggctgaccacgggcatggtcacaaaggagtgggctgcgatccat
cgcaagcaccacgccaagtgcgaaaccgaagacgatccgcacagcccgcagacgcgcggc
atccgcaaggtgctgctggaaggcgccgagctgtaccgtgccgagtccaagaaccgcgag
accatccagaagttcggccacggcacgcccaacgactggatcgagcagaacctctattcc
aagtacacctggcagggcgtcggcctgatgctgatcctcgacgtgctgatgttcggcgcg
gtcggcctgactgtgtgggcggtgcagatgctgtggattccggtgcatgccgccggcatc
atcaacgggctgggccactactggggctatcgcaatttcgactgcgaagatgcctcgacc
aacgtgtttccgtgggggctgatcatcggcggcgaagagctgcacaacaatcaccacacg
tacgccacatcggccaagttctcgatcaagtggtacgagttcgatgtgggctggggctac
atccgcgcgctggagatggtgggcctggccaaggtcaagaaggtggcgcccaaggcacgc
ttcggcgacgtcaagccggtcgaccagaacacgctggaagccatcatcgccaaccgctac
gacgtgatggcccgctacgccaagaccgtcaaggccgcctaccgtcaagagctggccagg
ctgaaggctgaccgtgacgtggaataccgtgcgctgaagccggccagcaagtggttccat
cgcgatgaagccaagctgggcgcaccccagcgcgaacagctgtcgcagatcgtgtcggac
cattccgcgctgcacactttcgtcgagatgcgccgcgaactgggcgcgctgtggggacgt
tcgaacgccacgcgcgagcaactgctgcaccagttgcaggaatggtgcaagcgcgcggag
gaaagcgggattcatgcgctgcaggagttcgccctgcgcctgcgccgctacgcctga

DBGET integrated database retrieval system