KEGG   Ralstonia solanacearum Po82: RSPO_c01099Help
Entry
RSPO_c01099       CDS       T02005                                 

Gene name
hemX
Definition
(GenBank) bifunctional protein: uroporphyrin-III
  KO
K13543  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00860  Porphyrin and chlorophyll metabolism
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSPO_c01099 (hemX)
Enzymes [BR:rsn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RSPO_c01099 (hemX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RSPO_c01099 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX HEM4 FTCD_C DUF3584
Motif
Other DBs
NCBI-ProteinID: AEG68400
UniProt: F6FZA9
Position
1148899..1150986
Genome map
AA seq 695 aa AA seqDB search
MDDRSPSPSSVPPDALPHPSAPVVVVTRPRAQAPMLVAALERHGLRTFQFPLLDIAPTPN
LDDLRAALADPSRYALVVFVSPNAVQQAFSAMPEGFRWPQDVPVAVVGPASAQALAAHGV
EPPTHSVIRPDTHADDARQDSEALYARLDPAQLSGREVLLVRGNGGREWLADRLREAGVA
VRAVEAYRRSVPVPDAAAWAALREVLAGRHAWTLTSSEAVRNLDSLAHASLTAAEVDTLH
AAPCFAPHARIVEQAQSLGFRDVTLTDAGDDRLLAGLLAWAGPVAPVAEAVPSPAPAAAP
AEPKPSSPAPIVSQTSAPSSVPAPGPAAASPGPAAAPAAPTTTVSARPGRGNWLLWAALI
VVLVVVAGLQVRNERLAREVRQRAQQNETLAQEMRVLSRNDQDAFAQLQQKFGALDARTA
ETRDRQGALEQASQDLLRNRDDWQRAEIERSLEVASEQLQLTGNVSSALVALQTIDARLA
SLDKPQFRAMRRAVARDIAKLKALPAIDLSGAAIRLDDAINGIDALPLVSSALPLESQQA
AQAPHGRSAKPAKAVAPASAPAAPVAAQTGWSAGVRAWWGRLWHDVRHELGQIVQVRRVD
QAEALLLSSDQAWFLRENLKLWLMNARLALLSRNEAVFRADLGRADALLARYFDPQSPRV
VAEQTLLQQARASVGTLEVPTLADSLAAARGQGKE
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccgctcgccctctccatccagcgtgccgcccgacgctctcccgcatccttcc
gcgcccgtcgtcgtggtcacgcggccgcgtgcgcaggcgcccatgctggtcgccgcgctg
gagcgccatgggctgcgcacgttccagtttccgctgctcgacatcgcacccacgcccaac
ctggacgacctgcgcgccgcgctggccgatccgtcgcgctatgcgctggtcgtgttcgtc
agtcccaatgccgtgcagcaggcgttttcggccatgcccgaaggcttccgctggccgcag
gacgtgccggtcgcggtggtcggccccgccagcgcccaggccctggccgcgcacggggtc
gagccgcccacgcacagtgtgatccggcccgacacgcatgccgacgacgcgcggcaggat
tccgaggcgctgtacgcgcgcctggacccggcgcagttgagcggccgcgaggtgctgctc
gtgcgcggcaacggcggccgcgagtggctggccgaccggttgcgcgaagccggcgtcgcg
gtgcgtgcggtggaagcatatcggcgcagcgtcccggtgcccgacgccgcggcctgggcc
gcgctgcgcgaggtgctggccggtcggcacgcctggacgctgaccagctccgaggcggtg
cgcaatctcgacagcctcgcgcacgccagcctgacggccgccgaagtcgatacgctgcac
gccgcgccgtgctttgcgccgcacgcccgcatcgttgaacaggcgcagtcgctgggcttc
cgtgacgtgacgctgaccgatgcgggcgacgaccgcctgctggccggcctgctggcctgg
gccggccccgtcgcgcctgtcgccgaggccgtgccgtcgccagcacccgcggcggcgccg
gccgaaccgaaaccttcctcacctgctccgatcgtgtcgcagacttccgctccctcgtcc
gttcccgcaccgggcccggccgccgcctcgccagggccggcggccgcgcctgccgccccg
accacgaccgtcagcgcgcgccctggccgcggcaactggctgctctgggctgcgctgatc
gtggtactcgtggtcgtggccggcctgcaggtccgcaatgagcggctggcccgcgaggtc
cgccagcgcgcgcagcagaacgagacgctggcgcaagagatgcgcgtgctgtcgcgcaac
gaccaggatgcctttgcccagctgcagcagaagttcggcgcgctggacgcccgtaccgcc
gaaacgcgcgaccgccagggcgcgctcgagcaggccagccaggatctgctgcgtaaccgc
gacgattggcagcgggccgagatcgagcgctcgctcgaagtcgcatccgagcaattgcag
ctcaccggcaacgtgagcagtgcgctggtcgcgctgcagaccatcgacgcgcgtctggcc
tcgctcgacaagccgcagttccgcgccatgcgccgcgccgtcgcccgcgatatcgccaag
ctcaaggcgctgccggccatcgacctgtcgggcgctgcgatccggctggacgatgcgatc
aacggcatcgatgcgctgccgctggtgtcgtctgccttgccgctggaatcgcagcaggcc
gcgcaggcgccgcatggccgttccgccaagccggccaaggccgtggcgccggcttcggca
ccggccgcaccggtggcggcgcagaccggctggtcggccggcgtgcgcgcctggtggggc
cgcctgtggcacgacgtgcgccacgagctgggccagatcgtgcaggtgcgccgcgtcgat
caggccgaggcgctgctgctgtcgtccgatcaggcgtggttcctgcgcgagaacctcaag
ctgtggctgatgaacgcgcggttggcgctgctgtcgcgcaacgaggcggtgttccgcgcc
gacctcggccgcgccgacgcgctgctcgcgcgctatttcgatccgcagtcgccgcgtgtc
gtggctgagcagaccctgctgcagcaggcgcgcgcgagcgtcggtacgctggaggtgccg
accttggccgacagcctcgccgccgcccgcggccagggcaaggagtga

DBGET integrated database retrieval system