KEGG   Ralstonia solanacearum Po82: RSPO_c01193Help
Entry
RSPO_c01193       CDS       T02005                                 

Gene name
galU1
Definition
utp--glucose-1-phosphate uridylyltransferase protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSPO_c01193 (galU1)
   00052 Galactose metabolism
    RSPO_c01193 (galU1)
   00500 Starch and sucrose metabolism
    RSPO_c01193 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    RSPO_c01193 (galU1)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSPO_c01193 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1256288..1257160)
Genome map
AA seq 290 aa AA seqDB search
MQRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGNAPFAVILADDLLDGNPPVMKQMVDLYDHYNCSVIGVEEIEREQSRSYGVVDGRPWE
EDGSVIKMSGIVEKPAPENAPSNLGVVGRYILTPRIFDHIRNIKPGAGGELQLTDAIQSL
LSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVAAEFREYLASRG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgtcaccaaagccgtcttccccgttgcgggactgggaacccgcttcctgccc
gccaccaaggccagcccgaaggaaatgctgccggtggtcgacaaacccctgatccagtac
gccgtggaagaagccatggccgccggcatcaccgagatgatcttcgtgaccggccgcagc
aagcgcgccatcgaagaccacttcgacaaggcctacgagctggaagccgaactggaagcc
aagcagaagacggcgctgctcgaagtggtgcgctcgatcaagccgtcgcacgtggactgc
ttctacgtgcgccagccggaagcgctgggcctgggccacgcggtgctgtgcgccgaaaag
ctggtcggcaacgcgcccttcgcggtcatcctggccgacgacctgctcgacggcaatccg
ccggtgatgaagcagatggtcgacctgtatgaccactacaactgctcggtgatcggcgtg
gaagagatcgagcgcgagcagagccgctcgtacggcgtggtcgacggccgcccgtgggaa
gaggacggcagcgtgatcaagatgtcgggcatcgtcgagaagccggccccggaaaatgcc
ccgtccaacctgggcgtggtcggccgctacatcctcacgccgcgcatcttcgaccatatc
cgcaatatcaagccgggcgcgggcggcgagctgcagctcacggatgcgatccagtcgctg
ctgtcggccgagcaggtgctggcctaccgctacaagggcgtgcgctacgactgcggcagc
aagctgggctacctgaaggccacggtcgaactggcgctcaagcacaaggaagtggccgcg
gagttccgcgagtacctggcctcgcgcggctga

DBGET integrated database retrieval system