KEGG   Ralstonia solanacearum Po82: RSPO_c01193Help
Entry
RSPO_c01193       CDS       T02005                                 

Gene name
galU1
Definition
(GenBank) utp--glucose-1-phosphate uridylyltransferase protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00040  Pentose and glucuronate interconversions
rsn00052  Galactose metabolism
rsn00500  Starch and sucrose metabolism
rsn00520  Amino sugar and nucleotide sugar metabolism
rsn01100  Metabolic pathways
rsn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSPO_c01193 (galU1)
   00052 Galactose metabolism
    RSPO_c01193 (galU1)
   00500 Starch and sucrose metabolism
    RSPO_c01193 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    RSPO_c01193 (galU1)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RSPO_c01193 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEG68494
UniProt: F6FZC6
Position
complement(1256288..1257160)
Genome map
AA seq 290 aa AA seqDB search
MQRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKAYELEAELEAKQKTALLEVVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGNAPFAVILADDLLDGNPPVMKQMVDLYDHYNCSVIGVEEIEREQSRSYGVVDGRPWE
EDGSVIKMSGIVEKPAPENAPSNLGVVGRYILTPRIFDHIRNIKPGAGGELQLTDAIQSL
LSAEQVLAYRYKGVRYDCGSKLGYLKATVELALKHKEVAAEFREYLASRG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgtcaccaaagccgtcttccccgttgcgggactgggaacccgcttcctgccc
gccaccaaggccagcccgaaggaaatgctgccggtggtcgacaaacccctgatccagtac
gccgtggaagaagccatggccgccggcatcaccgagatgatcttcgtgaccggccgcagc
aagcgcgccatcgaagaccacttcgacaaggcctacgagctggaagccgaactggaagcc
aagcagaagacggcgctgctcgaagtggtgcgctcgatcaagccgtcgcacgtggactgc
ttctacgtgcgccagccggaagcgctgggcctgggccacgcggtgctgtgcgccgaaaag
ctggtcggcaacgcgcccttcgcggtcatcctggccgacgacctgctcgacggcaatccg
ccggtgatgaagcagatggtcgacctgtatgaccactacaactgctcggtgatcggcgtg
gaagagatcgagcgcgagcagagccgctcgtacggcgtggtcgacggccgcccgtgggaa
gaggacggcagcgtgatcaagatgtcgggcatcgtcgagaagccggccccggaaaatgcc
ccgtccaacctgggcgtggtcggccgctacatcctcacgccgcgcatcttcgaccatatc
cgcaatatcaagccgggcgcgggcggcgagctgcagctcacggatgcgatccagtcgctg
ctgtcggccgagcaggtgctggcctaccgctacaagggcgtgcgctacgactgcggcagc
aagctgggctacctgaaggccacggtcgaactggcgctcaagcacaaggaagtggccgcg
gagttccgcgagtacctggcctcgcgcggctga

DBGET integrated database retrieval system