KEGG   Ralstonia solanacearum Po82: RSPO_c01299Help
Entry
RSPO_c01299       CDS       T02005                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase (gmp kinase) protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00230  Purine metabolism
rsn01100  Metabolic pathways
Module
rsn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RSPO_c01299 (gmk)
Enzymes [BR:rsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RSPO_c01299 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 AAA_16 ABC_tran AAA_29 AAA_25 Septin AAA_30 AAA_23 cobW AAA_18 Dynamin_N Viral_helicase1 GTP_EFTU
Motif
Other DBs
NCBI-ProteinID: AEG68600
UniProt: F6G017
Position
1375233..1375898
Genome map
AA seq 221 aa AA seqDB search
MPSSQAHSAVDTPIENHFPGSLFMVVAPSGAGKSTLVNALLAQDPSIRLSVSATTRKPRP
GEQHGREYNFMTVDEFKACRDRGEFLEWAEVHGNYYATSRVWIEEQMRAGTDVLLEIDWQ
GAQQVHRRFANAVEIFILPPSLTALEDRLKKRGQDEPNVIVRRLLAAGSEMAHAPEADYV
IINEVFETALAELRTVVQAARLRYMAQKARHAELFVELGIH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcccaagcgcattcggcggtcgatacgcccatcgaaaaccacttccccggc
agcctgttcatggtggtggcgccttccggcgcgggcaaatcgacgctggtgaacgcgctg
ctggcgcaggacccgtcgatccgcctgtccgtctccgccaccacgcgcaagccgcggccg
ggcgagcagcacggccgcgaatacaacttcatgacggtcgacgagttcaaggcctgccgc
gatcgcggcgagtttctcgaatgggccgaggtgcacggcaactactacgcgacctcgcgc
gtgtggatcgaagagcagatgcgcgccggcaccgacgtgctgctggagatcgactggcag
ggcgcgcagcaggtgcatcgccgcttcgccaatgcggtcgagatcttcatcctgccgccg
tcgctgaccgcgctcgaagaccgcctgaagaagcgcggccaggacgagcccaacgtgatc
gtgcgccggctgctcgccgcgggcagcgaaatggcgcatgcacccgaggccgactacgtg
atcatcaacgaagtcttcgagaccgcgctggccgagctgcgcaccgtggtgcaggccgcg
cgtctgcgctatatggcgcagaaggcacggcacgccgaactcttcgtcgagctgggcatt
cactga

DBGET integrated database retrieval system