KEGG   Ralstonia solanacearum Po82: RSPO_c01370Help
Entry
RSPO_c01370       CDS       T02005                                 

Gene name
tpiA
Definition
triosephosphate isomerase (tim) (triose-phosphateisomerase) protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPO_c01370 (tpiA)
   01230 Biosynthesis of amino acids
    RSPO_c01370 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_c01370 (tpiA)
   00051 Fructose and mannose metabolism
    RSPO_c01370 (tpiA)
   00562 Inositol phosphate metabolism
    RSPO_c01370 (tpiA)
Enzymes [BR:rsn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSPO_c01370 (tpiA)
Exosome [BR:rsn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSPO_c01370 (tpiA)
  Exosomal proteins of bladder cancer cells
   RSPO_c01370 (tpiA)
  Exosomal proteins of melanoma cells
   RSPO_c01370 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1445199..1445969
Genome map
AA seq 256 aa AA seqDB search
MSTWRNNNVSARPKLVVGNWKLHGSLNGNAELLEKIKAAGQTRAALAVCAPFPYLAQCQS
LLAGSAVAWGAQDVSAEARGAFTGEVAASMLSEFGCGYAIVGHSERRTYHGEADAQVAAK
ALRALEHGITPIVCVGETLAQREAGETEQVVARQLGAVLEALSVEQLGGIVVAYEPVWAI
GTGKTATSEQAQAVHAFLRGRVAACDAGVAQRMPILYGGSVKPDNAAELFAMADIDGGLI
GGASLKAEDFLAIGRA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ctgtcgacctggcggaacaacaacgtgagcgcaagaccgaagctggtggtgggcaactgg
aagttgcatggcagcctgaacggcaatgccgaactgcttgagaagatcaaggcggctggc
cagacccgcgccgcgctggcagtctgcgcgccgttcccgtacctggcccaatgccagtcg
ctgctcgccggctcggcagtggcctggggtgcgcaggatgtgtcggccgaggcgcgtggc
gccttcaccggcgaggtggcggcgtcgatgctgtccgaattcggctgcggctacgcgatc
gtggggcactccgagcgccgcacgtatcacggcgaggccgacgcgcaagtggcggccaag
gcgctgcgtgcgctggagcacggcatcaccccgatcgtctgtgttggcgaaacattggca
cagcgcgaagccggggagaccgagcaggtcgtggcccgtcaactgggcgcggtgctggag
gcgctgtcggtggagcaactgggcggtatcgtcgtggcctatgagccggtctgggccatc
ggcaccggcaagaccgcgaccagcgagcaggcgcaggcggtgcatgcgttcctgcgcggc
cgcgtggccgcctgcgacgccggtgttgcgcagcgcatgccgatcctgtacggcggcagc
gtcaagcccgacaacgctgccgagctgtttgcgatggccgacatcgatggcggcctgatc
ggcggcgcatccctgaaggccgaagatttcctggcgatcggccgggcctga

DBGET integrated database retrieval system