KEGG   Ralstonia solanacearum Po82: RSPO_c01370Help
Entry
RSPO_c01370       CDS       T02005                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (tim) (triose-phosphateisomerase) protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00010  Glycolysis / Gluconeogenesis
rsn00051  Fructose and mannose metabolism
rsn00562  Inositol phosphate metabolism
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01200  Carbon metabolism
rsn01230  Biosynthesis of amino acids
Module
rsn_M00002  Glycolysis, core module involving three-carbon compounds
rsn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPO_c01370 (tpiA)
   00051 Fructose and mannose metabolism
    RSPO_c01370 (tpiA)
   00562 Inositol phosphate metabolism
    RSPO_c01370 (tpiA)
Enzymes [BR:rsn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSPO_c01370 (tpiA)
Exosome [BR:rsn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSPO_c01370 (tpiA)
  Exosomal proteins of bladder cancer cells
   RSPO_c01370 (tpiA)
  Exosomal proteins of melanoma cells
   RSPO_c01370 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEG68670
UniProt: F6G087
Position
1445199..1445969
Genome map
AA seq 256 aa AA seqDB search
MSTWRNNNVSARPKLVVGNWKLHGSLNGNAELLEKIKAAGQTRAALAVCAPFPYLAQCQS
LLAGSAVAWGAQDVSAEARGAFTGEVAASMLSEFGCGYAIVGHSERRTYHGEADAQVAAK
ALRALEHGITPIVCVGETLAQREAGETEQVVARQLGAVLEALSVEQLGGIVVAYEPVWAI
GTGKTATSEQAQAVHAFLRGRVAACDAGVAQRMPILYGGSVKPDNAAELFAMADIDGGLI
GGASLKAEDFLAIGRA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ctgtcgacctggcggaacaacaacgtgagcgcaagaccgaagctggtggtgggcaactgg
aagttgcatggcagcctgaacggcaatgccgaactgcttgagaagatcaaggcggctggc
cagacccgcgccgcgctggcagtctgcgcgccgttcccgtacctggcccaatgccagtcg
ctgctcgccggctcggcagtggcctggggtgcgcaggatgtgtcggccgaggcgcgtggc
gccttcaccggcgaggtggcggcgtcgatgctgtccgaattcggctgcggctacgcgatc
gtggggcactccgagcgccgcacgtatcacggcgaggccgacgcgcaagtggcggccaag
gcgctgcgtgcgctggagcacggcatcaccccgatcgtctgtgttggcgaaacattggca
cagcgcgaagccggggagaccgagcaggtcgtggcccgtcaactgggcgcggtgctggag
gcgctgtcggtggagcaactgggcggtatcgtcgtggcctatgagccggtctgggccatc
ggcaccggcaagaccgcgaccagcgagcaggcgcaggcggtgcatgcgttcctgcgcggc
cgcgtggccgcctgcgacgccggtgttgcgcagcgcatgccgatcctgtacggcggcagc
gtcaagcccgacaacgctgccgagctgtttgcgatggccgacatcgatggcggcctgatc
ggcggcgcatccctgaaggccgaagatttcctggcgatcggccgggcctga

DBGET integrated database retrieval system