KEGG   Ralstonia solanacearum Po82: RSPO_c01443Help
Entry
RSPO_c01443       CDS       T02005                                 

Gene name
sdhD
Definition
transmembrane succinate dehydrogenase (hydrophobic membrane anchor protein subunit)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSPO_c01443 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSPO_c01443 (sdhD)
   00650 Butanoate metabolism
    RSPO_c01443 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RSPO_c01443 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512217..1512582
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVVMAVYTIVLLAAFLFSKDTSYQSWAGLFAN
QWMKLLTFVAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtggtcatggcggtctacaccatcgtgctgctg
gccgcgttcctgttctcgaaagacacgtcgtatcaaagctgggcaggcctgttcgccaac
cagtggatgaagctgctgacgttcgtcgccttcctgtcgctcacgtatcacgcctggatc
ggcgtgcgtgacatctggatggattacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgcgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system