KEGG   Ralstonia solanacearum Po82: RSPO_c01443Help
Entry
RSPO_c01443       CDS       T02005                                 

Gene name
sdhD
Definition
(GenBank) transmembrane succinate dehydrogenase (hydrophobic membrane anchor protein subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rsn  Ralstonia solanacearum Po82
Pathway
rsn00020  Citrate cycle (TCA cycle)
rsn00190  Oxidative phosphorylation
rsn00650  Butanoate metabolism
rsn01100  Metabolic pathways
rsn01110  Biosynthesis of secondary metabolites
rsn01120  Microbial metabolism in diverse environments
rsn01130  Biosynthesis of antibiotics
rsn01200  Carbon metabolism
Module
rsn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSPO_c01443 (sdhD)
   00650 Butanoate metabolism
    RSPO_c01443 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RSPO_c01443 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C MitoNEET_N
Motif
Other DBs
NCBI-ProteinID: AEG68743
UniProt: F6G0G0
Position
1512217..1512582
Genome map
AA seq 121 aa AA seqDB search
MAQNNIGPKRLVVGAHYGLKDFLAQRVTAVVMAVYTIVLLAAFLFSKDTSYQSWAGLFAN
QWMKLLTFVAFLSLTYHAWIGVRDIWMDYVKPVAVRLTLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaatatcggtcccaagcgcctcgtcgtcggcgcacactacggcctgaag
gacttcctcgcgcagcgcgtcaccgccgtggtcatggcggtctacaccatcgtgctgctg
gccgcgttcctgttctcgaaagacacgtcgtatcaaagctgggcaggcctgttcgccaac
cagtggatgaagctgctgacgttcgtcgccttcctgtcgctcacgtatcacgcctggatc
ggcgtgcgtgacatctggatggattacgtgaagcccgtggcagtgcgtttgacgctgcaa
gtgttgacgattctgtggctcgtcggttgcgcgggctacgcagctcagattctctggagg
gtttaa

DBGET integrated database retrieval system