KEGG   Ralstonia solanacearum Po82: RSPO_c01457Help
Entry
RSPO_c01457       CDS       T02005                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPO_c01457 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPO_c01457 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSPO_c01457 (trpB)
Enzymes [BR:rsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSPO_c01457 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1526691..1527884
Genome map
AA seq 397 aa AA seqDB search
MYNLPDAHGHFGPYGGTFVAETLSHALDELRDAYARYQHDPEFIKEYEYELKHFVGRPSP
IYHARRLTEHCGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVADTFYIIGTVAGPHPYPMMVRDFQSVIGEECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDHADVKLIGVEAAGEGIESGRHAASLTGGSPGVLHGNRTYLLQDEDGQIIET
HSISAGLDYPGVGPEHAWLKDAGRAQYVGITDKEALQAFHDLCRMEGIIPALESSHALAY
ACKLAPTLPKDQILLVNLSGRGDKDMHTVAELSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctgcccgacgcccacggccacttcggaccctacggcggtacctttgtcgca
gaaaccctgtcccacgcgctggacgaactgcgcgatgcctacgcgcgctaccagcacgat
cccgagttcatcaaggaatacgagtacgagctgaagcatttcgtcggccgtccgtcgccc
atctaccatgcccgccgcctgaccgagcattgcggcggcgcgcagatctacctcaagcgc
gaagacctgaaccacaccggcgcccacaaggtgaacaacgtcatcggccaggcgctgctg
gcgcgccgcatgggcaagccgcgcgtgatcgccgagaccggcgccggccagcacggcgtg
gcgacggccaccatcgccgcgcgctacggcatggaatgcgtggtctacatgggcagcgag
gatgtgcgccgtcaggccgccaacgtctatcgcatgaagctgctgggcgcgaccgtggtg
ccggtggaatccggctcgcgcacgctcaaggatgcgctcaacgaagccatgcgcgactgg
gtcaccaatgtggccgacaccttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagtcggtgatcggcgaggagtgcaaggtgcagatgccc
gaactggccggccgccagccggatgcggtgatcgcctgcgtgggcggcggctccaatgcc
atgggcatcttctatccgtacatcgaccatgccgatgtcaagctgatcggcgtggaagcg
gcgggcgagggcatcgagtcgggccgtcatgccgcatcgctcacgggcggttcgccgggc
gtgctgcacggcaaccgcacctatctgctgcaggacgaggacggccagatcatcgagacg
cattcgatctcggcgggtctggattatccgggcgtcggtcccgagcatgcctggctgaag
gacgccggccgcgcgcagtatgtcggcatcaccgacaaggaagcgctgcaggccttccac
gacctgtgccgcatggagggcattattccagcgctggagtcgagccacgcgctggcctat
gcctgcaagctggcgccgacgctgcccaaggaccagatcctgctggtcaacctgtccggc
cgcggcgacaaggacatgcataccgtcgccgaactctcgggcatcgagctctga

DBGET integrated database retrieval system