KEGG   Ralstonia solanacearum Po82: RSPO_c01459Help
Entry
RSPO_c01459       CDS       T02005                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain protein
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsn  Ralstonia solanacearum Po82
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSPO_c01459 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPO_c01459 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSPO_c01459 (trpA)
Enzymes [BR:rsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSPO_c01459 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1528722..1529519
Genome map
AA seq 265 aa AA seqDB search
MSRIAQTFSQLSAQGRKGLIPFITAGDPYPELTVDLMHALVKGGANVIELGVPFSDPMAD
GPVIQRASERALAKKIGLRTVLDYVRAFRATDKTTPVVLMGYANPIERMGIDAFAKAASE
AGVDGVLVVDYPPEECEAFARTMRATGIDPIFLLAPTSTEARIAQIARVASGYLYYVSLK
GVTGAATLDLDSVAARIPQIRQHARLPVGVGFGIRDAATARAIGGVADAVVIGSRIVQLL
EEAPREQAVQCLTDFIADIRRALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcgctcaaaccttttcgcaactgtccgcgcagggccgcaagggcctgatt
ccgttcatcacggcgggcgatccgtaccccgaactgaccgtcgacctgatgcacgcgctg
gtcaagggcggcgccaatgtcatcgaactgggcgtgccgttttccgacccgatggccgat
ggcccggtcatccagcgtgcgtcggagcgcgcactcgccaagaaaatcggtctgcgcacc
gtgctggattacgtacgtgcgttccgcgccaccgacaagacgacgcccgtggtgctgatg
ggctacgccaacccgatcgagcgcatgggcatcgacgccttcgccaaggccgcatcggaa
gccggcgtggatggcgtgctggtggtggactatccgcccgaggaatgcgaggcgttcgcc
aggaccatgcgggccacgggcatcgacccgattttcctgctggcgccgacctcgaccgaa
gcgcgcatcgcgcagatcgcccgcgtggcgagcggctacctctactacgtgtcgctcaag
ggcgtgacgggcgcggcgacgctggacctcgacagcgtggcggcacgcatcccgcagatc
cgccagcacgcgcggctgccggtgggtgtcggcttcggcatccgcgatgcggcgacggca
cgcgcgatcggcggtgtggccgatgcggtggtgatcggatcccgcattgtgcaattgctg
gaggaggccccccgcgaacaagcggtacaatgtctgactgatttcatcgcggacatccgc
cgggcgctcgacgcctga

DBGET integrated database retrieval system